KEGG   Nectria haematococca: NECHADRAFT_41174Help
Entry
NECHADRAFT_41174  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nhe  Nectria haematococca
Pathway
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_41174
   00500 Starch and sucrose metabolism
    NECHADRAFT_41174
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NECHADRAFT_41174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 9666367
NCBI-ProteinID: XP_003051456
JGI: 41174
UniProt: C7YT16
Position
5
AA seq 577 aa AA seqDB search
MTVTTTYTAAPTRKSQGFHPRPEYHLKAPQGWMNDPCAPAFDPTTGTYHIFYQWNPRSCE
WGHICWGHATSPDGLRWKHSTANPTLQPSEPYDNKGIWTGCLWPTGPKGEKDQLTVIYSS
ITCLDIHWTREHVRGSEGVSLATSTDNGKTWRKSDLNPIVKNEPEGLRVTGFRDPFLATW
PALDEIQGEKSLYGILSGGIAGKTPTIFIYAVSPTDLAEWKYMGPLVDLAPGFRVPGPWT
GDFGVNWECVNYMTLRGDTEERDFLLMGTEGGHKRSDKERKPDELFAWCLWLAGSLEQTA
EGPRLRHDFDGILDHGTLYAPNSYEHPVTKKRIAFGWIKEEELTLARREAKGWTGYLSLP
RELFLYTATNVARGLKSSLNEIRSIKAIPDASGANTIQTLGIRPLDDLYLLRPSRPDEWS
AIGSSDTSGILKHHTRSTSWELEALINLHAPHPRLVGFHICHNTDTSLRASISFDTQEER
IVVDRSASNHEPDIRKDTQSGAFTLFYTRDEGRETLEPLRLRIFRDGDTLEIFANDRFAL
STTVCVDETCGGLSWFVEGGGGAESVFETIRLWDGLE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcactacgacatataccgccgcgccgacacggaagtcgcagggcttccatcct
cgaccagagtatcacctcaaggccccgcagggatggatgaacgacccctgcgctccagcc
tttgatccaacgacaggcacatatcacatcttctatcaatggaaccctcggtcttgtgaa
tggggccacatctgctggggtcatgccactagccctgacggcctacgttggaagcacagc
acagccaacccaacactccaacccagtgagccatatgataacaagggcatctggacaggt
tgtctatggccaactgggcctaaaggcgagaaggaccagctcacggttatctactcatcc
atcacatgcctcgacattcactggacccgtgagcatgtccgtggctccgaaggcgtatcg
ttggcgacgtctacggacaacggaaagacgtggaggaagagcgacctaaaccccatcgtt
aagaatgagccggaaggcctcagggtgacaggcttcagggacccgttccttgcgacttgg
cctgctcttgatgagattcaaggcgagaagagcctctatgggattctttcaggcgggatt
gccggcaagaccccaaccatcttcatctacgccgtctccccgaccgaccttgccgagtgg
aaatacatgggacccctagttgatcttgcccctggcttccgtgtccccgggccttggaca
ggcgactttggcgtcaactgggagtgtgttaactacatgaccttgcgaggcgacactgaa
gagcgcgactttctccttatggggacggagggaggtcacaagcgcagcgataaggagaga
aagcctgatgagcttttcgcgtggtgcctctggctcgctggctctctcgagcagactgca
gaaggcccgaggttaaggcatgactttgacgggatcctggatcacggaaccttgtacgcg
ccaaactcgtatgagcatcccgtcacaaagaagaggatcgcgttcggatggatcaaggag
gaagagctcacgctggctcggcgtgaggctaagggctggacgggatacctgtcgcttccc
agggagctcttcttgtacaccgcaacaaacgtggccaggggcttaaagtcgtcgttgaat
gagatccgctctatcaaagcgatccccgacgcctcgggggccaacaccatacagacgctc
ggcatccggccgctcgacgacctgtacctcctccggccctctcgaccagacgagtggtca
gccattggcagttctgatacttcaggtatcttgaaacatcacactcgctcgacgagctgg
gagctggaagccctcatcaacttacacgccccgcacccccggctcgtaggcttccacatc
tgtcacaacactgatacctcgctgcgggctagcatctcctttgacacgcaagaggagaga
attgtggtggacaggagcgcgtcgaaccacgaacctgacattcgaaaagatactcaatcg
ggggcgttcacactcttctacacccgcgatgaggggcgcgagacgctggagccgctcagg
ctacgcatcttccgagatggagatacgctggaaatctttgcgaatgatcggttcgcgctg
agcacgacagtctgtgtagatgagacgtgtggggggctcagctggtttgtcgagggcggt
ggcggtgcggagagcgtgtttgagacgattcggctatgggatggtctcgagtga

DBGET integrated database retrieval system