KEGG   Nectria haematococca: NECHADRAFT_46268Help
Entry
NECHADRAFT_46268  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
nhe  Nectria haematococca
Pathway
nhe00270  Cysteine and methionine metabolism
nhe00330  Arginine and proline metabolism
nhe01100  Metabolic pathways
Module
nhe_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NECHADRAFT_46268
   00330 Arginine and proline metabolism
    NECHADRAFT_46268
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     NECHADRAFT_46268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_decarbox
Motif
Other DBs
NCBI-GeneID: 9675484
NCBI-ProteinID: XP_003047074
JGI: 46268
UniProt: C7Z3S7
Position
8
AA seq 502 aa AA seqDB search
MFPSSVPNNCTFSPASATPHLTINHDVAADLDSTNAFEGPEKLLEVWFAPSPTSLPPTAP
VNGLKAVPADTWVPMLDMVNCKVLSVLDSDNMDAYLLSESSMFVFPHKIILKTCGTTTLL
LGLQRMLHIAAKYGFPFHNANSVNDIHAAATPYRVFYSRKNFLFPEKQQGPHRSWKQEVK
YLDDMFDGGSAYMVGKMNGDHWYLYLTSPNQQALTPPRTPESEVNVPVARIPVGTSFGTG
PSGHHDETLEILMTDLDPENAKQFYLSHASAVASDKLAVEAQDARKQAIHSLGGLDAVDE
VDVFCNGDEEPMLDSTEALTTEGHALGTVVSESCGLSSVYPTADYPDARVDAYLFSPCGF
SANGVVPPKAEGAGSEHYFTVHVTPEPHCSFASFETNVPGGQSGRTTTEIIEQVVNIFKP
GRFSVTLFEAKAQAHNPYGMGDDDTKGWAANRLVDPVRGYRRIDRIVHDFEDYDLVFRFY
EREGWAGTKNARVGEPASPTLK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtttccctcttcggttcccaacaactgtaccttctcgccggcctcggccactccccat
ctgaccatcaaccatgatgtggccgccgacctcgactcgaccaatgctttcgagggcccc
gagaagcttcttgaagtctggttcgccccgagcccgacttctctgcctccaactgccccc
gtcaatggtctaaaggctgttcctgctgatacctgggtcccaatgctcgacatggtcaac
tgcaaggttctctctgtgcttgactctgacaatatggatgcctatctcttgtccgagtct
agcatgtttgtctttcctcacaagatcattctcaagacatgcggcaccacgacccttctt
ctaggactccagcgtatgcttcacattgcggccaagtacggattcccattccacaatgcc
aactctgtcaacgatatccatgctgctgccactccctaccgcgtcttttacagtcgcaag
aactttttgttccccgagaagcagcagggaccccatcgcagctggaagcaggaggtcaag
tacctcgacgacatgtttgacggtggaagtgcctatatggtgggcaagatgaacggtgac
cactggtacttgtacctcacgtctccgaaccagcaggccttgactcctccaaggaccccc
gagtccgaagtcaacgttcctgtggccaggatccccgtcgggacatcgtttggtactggc
cccagcggtcatcacgacgagacgctcgaaatcctcatgacggacctcgatcctgagaat
gccaagcagttttacttgtcgcatgcgagtgcggtcgctagcgataagttggctgtagag
gcccaggatgcccgcaaacaggccattcacagcctgggcgggcttgatgcagttgacgaa
gtggacgtcttctgcaacggggatgaggaaccaatgctcgattctaccgaggctctgact
accgagggccacgctctgggaactgtcgtgtcggagagctgcggcctctccagtgtctac
ccgaccgccgactatcctgacgcgcgtgtcgatgcctacctcttcagcccttgtggcttt
tctgccaatggagttgttcctcctaaggctgagggggccgggtctgagcattactttacc
gttcacgtcacccctgagcctcactgctcttttgcctcgttcgagaccaacgtccctggt
ggtcagagcggacgaaccacgaccgagattattgagcaggttgtcaacattttcaagcct
ggtcgcttcagcgtgactctgtttgaggccaaggctcaggctcacaacccttatggtatg
ggtgacgatgacaccaagggatgggcagccaaccgtctggttgatcctgtccggggatac
cgacgcattgatcgcattgtccatgactttgaggactacgatctcgtctttcgcttctat
gaacgggagggatgggccggcaccaagaatgcgcgagttggtgagcctgccagccctact
ctcaagtaa

DBGET integrated database retrieval system