KEGG   Nectria haematococca: NECHADRAFT_48604Help
Entry
NECHADRAFT_48604  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nhe  Nectria haematococca
Pathway
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_48604
   00500 Starch and sucrose metabolism
    NECHADRAFT_48604
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NECHADRAFT_48604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 9675086
NCBI-ProteinID: XP_003050690
JGI: 48604
UniProt: C7YVH2
Position
9
AA seq 592 aa AA seqDB search
MADNAQEQPRFHFFTNNWINDPCAPGYDPWTRTYHLFYQCNPEGCEWGNMSWGHAVSKDM
LTWSPASMSPALTPDQPYDSQGVFTGCWIPPANAGDKTLTVAYSSVRHLPFHWSTPPYPR
NAAGLAIATSHDGGVTWEKPPGNPVLAGEPAGLRVTGFRDPYVTRLPAISEALGSSAVTR
YGLISGGIQDVGPTTFLYAIDDDNVEEWKYLCPLVDVPARFQPSRKWCGNYGLNWECTNI
VTLHTNSESRHFLIIGAEGDVEKDHVKNHGKPAGVPSRTVRGQVWMSGELTRADDGVKFG
YNHGGYLDHGPLYAANSFVDPVSKRQVVYAWIPEEDIPLEAAKRKGWNGSLAIPREIFLL
RVPNVERTLHGTLAECHLFEVKAEADGSTTVLTLGVKPIDEMTRLREACTRVLKPETAVM
LPDRSDLAHLVVCQTQSLSWELEAIISVNPECDSVGFSIRHNQALSIHTTITFCAVTETI
IVDREASTTDPAINKCPDAGPFTLLMRKEDNGLVIEKLHLRIFSDGDILEIFANDRFALA
TMVYSKSHGQENSGITAFASGSAGSAVFESVTVWDGLDAKNVRTSIDSISAT
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaatgcccaagagcaacccagatttcatttcttcacaaacaactggatcaat
gacccatgcgctccagggtatgatccatggacgagaacataccaccttttctaccaatgc
aacccagaaggatgcgaatggggaaacatgtcctggggccacgcggtgtccaaggacatg
ctaacctggtcaccggcctctatgtcaccggcactcaccccagatcaaccttatgactct
caaggcgtctttaccggctgttggattcctcccgctaacgccggggataaaactctgaca
gtggcttactcctctgtcaggcatctcccgtttcactggagtactccgccatacccacgc
aacgcagctggcctcgcaatagcaacttcccatgatggcggcgtgacatgggaaaagcca
ccgggaaacccagttttagccggggagccggctggactgcgagtcactgggttccgagat
ccctatgtcacgcgattgccagctatcagcgaggctctgggctcaagtgccgtgactcgc
tatgggttgatctctggtggaatccaggatgtgggacccacgacgttcttgtacgcgatt
gatgacgataacgttgaagagtggaaatatctatgccccttggtcgacgtgccagccagg
tttcagccgtcaaggaagtggtgtggcaactacgggctcaactgggaatgcaccaacatc
gttacactgcatacaaactcagaaagtcgccattttctcatcatcggcgctgaaggtgac
gtggaaaaggaccatgtgaagaatcacggcaagcccgcaggagttccgtcgcgtaccgtc
agaggtcaggtgtggatgtcgggcgagctcactcgagccgacgacggggtcaagttcggg
tacaaccacgggggctacctcgaccacgggcctctctacgctgcgaactcgttcgttgat
cccgtctcaaagcgtcaagttgtctacgcatggatcccagaggaggatatccctcttgaa
gctgccaagcggaagggttggaatggctctcttgctattccgcgcgagatctttctgctt
cgggtgccaaatgtggagagaacccttcacggaacacttgcagagtgtcacctatttgaa
gtcaaggccgaggcagatggttctacaactgttctcactcttggagttaagcctatcgac
gagatgactcggcttcgagaagcatgtaccagagttctcaagccggaaactgcagtgatg
ctgccggataggagtgatttggcacatctggtagtttgtcagacacagtcattgagttgg
gagctcgaggcaatcatctcggtaaatcctgaatgcgactctgtgggcttcagcatccgc
cacaaccaagccctgtcaatccatacaaccattactttctgtgccgtcacggagaccatc
attgtcgaccgtgaggcgtcaacaactgacccagcaatcaacaaatgcccggatgctgga
ccctttaccctgttgatgcgcaaggaagacaacgggttggtgatagagaagctgcaccta
cgcatcttttctgacggagatattcttgaaatatttgcaaatgacaggtttgctttggct
acgatggtgtattcaaagagtcatggccaggagaacagcgggatcactgcgtttgcaagt
ggcagtgccggcagtgccgtctttgaaagtgtgacagtctgggatgggctggatgcaaag
aacgtgcgtacgagcatcgactcgatttcggcgacatag

DBGET integrated database retrieval system