KEGG   Nectria haematococca: NECHADRAFT_49818Help
Entry
NECHADRAFT_49818  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
nhe  Nectria haematococca
Pathway
nhe00680  Methane metabolism
nhe01100  Metabolic pathways
nhe01200  Carbon metabolism
Module
nhe_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NECHADRAFT_49818
Enzymes [BR:nhe01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     NECHADRAFT_49818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr E1_dh Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 9677628
NCBI-ProteinID: XP_003039717
JGI: 49818
UniProt: C7ZNZ4
Position
10
AA seq 738 aa AA seqDB search
MAPTLELYERAAVDKIPTKSLPTKGNGIVGLKLESPEKHDRVLKVFRAFIADLCQQFNGG
HPGSAMGMAAIGIALYKYAMRYSPNNCEYFNRDRFVLSNGHACLWQYLFMHLVGVKSMTL
EQLKSYHSTKTDSLCPGHPEIENEGVEVTTGPLGQGVANAVGLAMATKNLGATYNKPGYE
LVNNMTWCMIGDACLQEGVGLEAVSLAGHWRLNNLCIIYDNNSITCDGTADVANTEDINA
KMRATGWNVLDVFDGDSDVAAIVNALVAAKSSDKPTFINIRTTIGFGSSKAGNAKTHGAA
LGVDDVANIKKSFGLDSDKHFHIPQDVYDLFADVRTRGDAYEAEWQETVQRYKKEDPVLG
TEFGLRVAGKMPDDWTKCIPEKSELPTEPTASRKSAGIVTNILGERIKSFLIGTADLTPS
CNVAFNNKVDFQSPDLRTACGLNGNYSGRYIHYGIREHAMCAISNGLAAFNKGTFIPMTS
SFFMFYLYAAPAVRMAALQGLQQIHIATHDSIGTGEDGPTHQPIALPALYRAMPNTLYIR
PCDSEEVAGAFVAAIQATETPTIISLSRQNLTQYPQHSSREGVSLGAYVFVEAEGDDFDV
TLIGVGSEMGLTMQAKDLLLKEYGIKSRVVSFPCPRLFEQQSRQYKQSVLKPRSGKPTVV
VEAYAANGWERYADASISMRRFGKSLPSKAAYEYFGFQPDNVATKIKDFVEEVKRDGIEI
LRGDFRDLNGSLGVGFEH
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggctcctacactagaactttatgagcgggctgccgttgacaagatcccgaccaagtca
ctccccaccaagggcaacggcattgttggcctgaaactcgagagcccagagaaacatgat
agagtgttgaaggtttttagagccttcatcgcagacctctgccagcagttcaatggcgga
caccccgggtccgccatgggcatggcggcaattggcatcgctctttacaagtacgccatg
aggtactctcccaacaactgcgagtactttaaccgtgatcgcttcgtactgtccaacgga
catgcctgtttatggcaatacctcttcatgcaccttgttggtgtcaaaagtatgacactc
gaacagctcaaatcatatcactcaacaaagaccgattctctctgtcccggtcatcccgaa
atcgagaatgaaggtgtcgaagtcaccactggtcccctcggacaaggagtcgccaacgct
gttggtctcgccatggcaactaagaacctaggtgctacgtacaacaagccgggatacgag
ctggtgaataacatgacgtggtgcatgattggtgatgcctgccttcaggaaggcgttggc
ctcgaagcagtctctctcgcaggtcattggaggctcaataacctctgcattatttacgac
aacaactcgatcacttgtgatggcactgcggatgttgccaacactgaggatatcaatgcc
aagatgagggccactggatggaatgtgctggatgtgtttgatggcgactcggatgttgcc
gccatcgtcaatgccctcgtcgcagctaaatcaagcgacaagcccacctttatcaacatc
cgcacaaccatcggcttcgggtcttccaaggccggcaacgcgaagacacacggagccgct
cttggggttgacgacgtagccaacatcaagaaatctttcggtctcgactccgataagcat
ttccacatcccgcaagatgtctacgacttattcgcagatgttcgtacccgcggcgatgcc
tatgaggccgagtggcaggagactgtacagaggtacaagaaggaggatccggtgctgggg
acagaattcggtctccgtgttgctggaaagatgcccgacgactggacaaagtgcatcccc
gaaaagtcagagcttccaactgaacctacggcatcgcgaaaatctgcgggcattgtgacc
aatatccttggagagaggatcaagtccttcttgatcggcaccgcggatcttaccccttcg
tgcaatgtggccttcaacaacaaagtcgacttccaatcacccgatcttcgaactgcctgt
ggtttgaacggaaactacagtggccgctacatccattacggcatccgcgagcacgccatg
tgtgccatctctaacggcctcgctgcattcaacaagggcacattcatcccaatgacgagc
tctttcttcatgttctacctctatgccgccccggcggtccgaatggcagccctccaggga
ctccagcaaattcatatcgcaacccatgacagcatcggcaccggcgaggatggaccaaca
catcagccaattgccctgccggctctttaccgagctatgccaaacactttgtacatccgg
ccgtgcgattcggaagaggtagcaggcgctttcgtggctgctatccaggctactgaaacg
ccgaccatcatctccctgtctcggcagaacctgacacaatatccccagcactcttctcgc
gaaggtgtgagcttgggcgcgtacgtctttgtcgaggctgagggtgacgacttcgacgtg
actttgatcggagttggttccgagatgggactgacgatgcaggcaaaggatctgcttctc
aaagagtacggcatcaagtcaagagtagtctctttcccctgcccaagactctttgagcag
caatctcgacagtacaagcaatcggttttgaagcctcgctccggaaagcctacagtcgtt
gttgaggcgtatgccgcgaatggatgggagcgatacgccgatgcatccatatctatgagg
cgattcggaaaaagccttccgtccaaggcagcgtacgaatatttcggattccagcctgac
aacgttgcgacaaagatcaaggattttgtggaggaggtcaagagagatggtattgagata
ctgaggggcgatttcagggatctcaacggaagcttgggcgttggctttgagcactag

DBGET integrated database retrieval system