KEGG   Nectria haematococca: NECHADRAFT_50494Help
Entry
NECHADRAFT_50494  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nhe  Nectria haematococca
Pathway
nhe00350  Tyrosine metabolism
nhe00360  Phenylalanine metabolism
nhe00380  Tryptophan metabolism
nhe00901  Indole alkaloid biosynthesis
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_50494
   00360 Phenylalanine metabolism
    NECHADRAFT_50494
   00380 Tryptophan metabolism
    NECHADRAFT_50494
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    NECHADRAFT_50494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhe04147]
    NECHADRAFT_50494
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NECHADRAFT_50494
    4.1.1.105  L-tryptophan decarboxylase
     NECHADRAFT_50494
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_50494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 PBECR2
Motif
Other DBs
NCBI-GeneID: 9677784
NCBI-ProteinID: XP_003039851
JGI: 50494
UniProt: C7ZPF6
Position
10
AA seq 527 aa AA seqDB search
MDAQEFRQVAKAAIDEIIDWDENVASHRVVSDVKPGYLRPLLPSAPPQDGEPWADIHHDI
ETKIFPGITHWASPRFMAFFPCSSSYPAALAELYSNAFNGAHFNWICSPAVTELETIVMD
WLAQALGLPECFLSGGSTHGGGVIHGSASEAILTNMVAAREKYLAAVTAHLPDDTDEKEE
ATWEFRSKLVAVGSSGTHSSTKKAAQILGVRFATVPVFEEDGFSMTRVALETTISDLRAL
GLHPFYITTTLGSTDVCAVDDFEAVVEALKPIFDTPNEIWVHVDAAYAGTALLLDENKHL
AKAFSSFHSFSFNPHKWMLTTFDCSAVWVRRRAWLIQALSIKPPYLRNQFSDDELVTDYR
DWQIPLGRRFRSLKLWFVLRSFGVKGLQAHVRHGVELGESLQAKIESRPDLFTVFTKARF
GLVTLRINGSTEEEINERTEAVYEKINADGEFFLTATVINRKFAIRVCTGVAKVEEEHVQ
RVFEVLVEQAESRVLKKAVTNGTADVQIANKTETPLVNRAKAQATKA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcaagagtttcgacaagtggccaaggcggccatcgatgagatcatcgactgg
gatgaaaacgtcgcctctcatcgcgtcgtctccgatgtgaagcctggatacctccggcct
cttctcccctctgcgccgcctcaagatggtgagccgtgggccgatatccatcacgacatc
gagaccaagatattccccggcatcacccactgggccagtcctcgcttcatggcctttttt
ccctgctcgagcagttatcccgcagctctagctgagctctactccaatgctttcaatggc
gctcacttcaactggatttgtagtccggctgttactgagctcgagactattgtcatggat
tggcttgctcaggcccttggtcttccagagtgttttttgagtggaggatctactcatggc
ggtggtgtcattcacggcagtgccagtgaggctattctcacaaacatggtggctgctcgt
gaaaagtacctcgctgccgttactgctcacctccccgacgacacggatgagaaggaggag
gccacgtgggagtttaggagcaagcttgttgctgttggcagctcgggtactcactctagc
accaagaaggctgctcagatcctcggagttcgcttcgctactgttcccgtctttgaggag
gatggcttctccatgacccgtgtcgctctcgagactactatttctgaccttcgcgctctg
ggcctgcatccgttctacatcaccacaacccttggatctaccgacgtgtgtgccgttgac
gactttgaggctgtagttgaagctctcaagcccatctttgacacccccaacgagatctgg
gtccacgtcgatgccgcctacgcaggaaccgccctcctcctcgacgagaacaagcatctc
gccaaggccttctcttccttccactccttcagcttcaacccacacaagtggatgctcacc
accttcgactgctccgccgtttgggtccgtcgccgcgcctggctcatccaggccctgagc
atcaagcccccttacctccgcaaccagttcagcgacgatgagctcgtcaccgactatcgt
gactggcagattcccctgggtcgtcgattccgctctctcaagctttggtttgtgctccga
agctttggcgtcaagggtcttcaggctcatgttcgtcatggtgttgaactgggagagtct
cttcaagccaagatcgaatctcgaccagatctctttactgtattcacaaaggcacgcttc
ggattagtcactctacgcatcaacggctcaaccgaagaggagatcaacgagcgcaccgaa
gccgtatacgagaaaatcaatgcagacggcgaattcttcctcacagcgacagtcatcaac
cgcaagtttgccatccgcgtgtgcacaggtgtggcaaaggtcgaggaggagcacgtccag
cgagtgtttgaggttctggtcgagcaggcagagagtcgggtgctcaagaaggccgtgacc
aacgggacggcggatgttcagattgccaacaagaccgagactccccttgtcaatagggcc
aaggctcaggcgaccaaggcgtag

DBGET integrated database retrieval system