KEGG   Nectria haematococca: NECHADRAFT_50834Help
Entry
NECHADRAFT_50834  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
nhe  Nectria haematococca
Pathway
nhe00230  Purine metabolism
nhe00240  Pyrimidine metabolism
nhe00760  Nicotinate and nicotinamide metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NECHADRAFT_50834
   00240 Pyrimidine metabolism
    NECHADRAFT_50834
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NECHADRAFT_50834
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NECHADRAFT_50834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos YmdB
Motif
Other DBs
NCBI-GeneID: 9671615
NCBI-ProteinID: XP_003047662
JGI: 50834
UniProt: C7Z264
Position
10
AA seq 595 aa AA seqDB search
MKVFALGALALASSALAEDVLYSKRLVKRFVDDDGNYNMSFFHVNDVHAHLDEFSSSGTD
CVDPKKGCYGGYARIKHTVDGLREEYPDNLWLNAGDEFQGTLFYSFYGPEKIAETLNDLE
FDAMTLGNHEWDGGDEELGEFLKNLTFPVISCNVKSEYENLNKTIKNYHIFEEHDLAVIG
VTTDTTPGISSVGNLTTFLDPIEEVQKSVYEIRNNTDIKRIVALTHIGYDVDKELAAKTE
GISLIIGGHSHTPLGEMKNAEGKYPTIVENINGDEVFIVTAYRWGEYLGYIDLTFDKDGK
ALAYHGGPIHMDNKTDVDEDFEKKVKAWRGPFEEFAAEKVGNTKAELDQTQCQKGDCLLG
QVMADAMLEYRLNQSRSEDDKPALAFVNAGGVRATIDQGDITRGEVLTSFPFGNAIVELT
FTGAELEELFEGAVSRFNLNNKKPITSWFQVSKGLKIEYNPENNNGSKLISLTLDGKAFE
NETDYRVVTLDFLAGGGDNFIATPNKNLATLDSQDEVLIQYLDAYNPLDAKLEERVVTTN
ETSASEEEDQEEEAESGSGSSGGSGGSGSGENAASSSKVSLFSAVVGVAMVLLTM
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctttgctcttggtgccctcgctttggcgagctcggctttggctgaggatgtc
ctctacagcaagcgtttagtcaagcgctttgtcgatgacgatggcaactacaacatgtcc
ttcttccacgtcaatgatgtccacgcccatctcgacgagttctcctcttcgggcaccgac
tgcgtcgatcccaagaagggctgctatggtggctacgctcgcatcaagcacaccgtcgat
ggccttcgtgaggagtacccggacaacctctggctcaatgccggtgacgagttccaggga
accctcttctactccttctacggacctgagaagatcgccgagaccctcaacgacctcgag
tttgacgccatgacgcttggcaaccacgagtgggatggtggtgatgaggagcttggggag
ttcctcaagaacttgactttccctgtcatttcttgcaatgtcaagagcgagtacgagaac
ttgaacaagactatcaagaactaccacatctttgaggaacatgatctggctgtcattggc
gtcacaaccgacaccacccccggtatctcgagtgtcggcaacctgaccaccttccttgac
cccatcgaggaggtccaaaagtccgtctacgagattcgcaacaacaccgacatcaagcgc
atcgtcgccctcacccacattggctacgacgtcgacaaggagctcgccgccaagaccgag
ggcatctcactcatcatcggcggccacagccacactccccttggagagatgaagaacgcc
gagggcaagtaccctaccattgttgagaacatcaacggtgacgaggtctttatcgtgact
gcgtaccgatggggcgagtacctcggctacattgatctgacctttgacaaggacggcaag
gcccttgcctaccacggaggccccattcacatggataacaagaccgacgtggatgaggac
tttgagaagaaggtcaaggcctggcgtggaccgtttgaggagtttgctgctgaaaaggtt
ggtaataccaaggctgagctcgaccagacccagtgccagaagggagactgccttctcggc
caggtcatggccgacgccatgctcgagtaccgtcttaaccagagccgcagcgaggatgat
aagcctgctcttgcctttgtcaacgccggtggtgtccgcgccaccatcgaccagggcgac
atcacccgtggcgaagtcctcacctcgttcccctttggcaacgccatcgtcgagctcact
tttaccggagccgagctggaggagctatttgaaggcgccgtgtcccgcttcaacctgaac
aacaagaagcccatcacctcgtggttccaggtttccaagggtctcaagatcgagtataac
cctgagaacaacaatggctccaagctcatcagcctcaccctcgacggcaaggctttcgag
aacgagaccgactaccgtgtcgtcacgcttgatttcctggctggaggcggtgacaatttt
attgccacacccaacaagaacctggctactctggatagccaggatgaggtgctcattcag
tacctcgacgcgtataaccccctggacgccaagctggaagagcgtgtggtgacgacgaac
gagactagcgcttctgaggaggaagaccaggaggaggaggccgagtcgggttccggaagc
agcggaggtagtggaggtagcggtagcggagagaatgcggccagcagttccaaggtgtcg
ctgttttctgctgttgtgggtgttgccatggtcctgttgacaatgtaa

DBGET integrated database retrieval system