KEGG   Nectria haematococca: NECHADRAFT_53807Help
Entry
NECHADRAFT_53807  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
nhe  Nectria haematococca
Pathway
nhe00564  Glycerophospholipid metabolism
nhe00565  Ether lipid metabolism
nhe00590  Arachidonic acid metabolism
nhe00591  Linoleic acid metabolism
nhe00592  alpha-Linolenic acid metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NECHADRAFT_53807
   00565 Ether lipid metabolism
    NECHADRAFT_53807
   00590 Arachidonic acid metabolism
    NECHADRAFT_53807
   00591 Linoleic acid metabolism
    NECHADRAFT_53807
   00592 alpha-Linolenic acid metabolism
    NECHADRAFT_53807
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NECHADRAFT_53807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 9676210
NCBI-ProteinID: XP_003047293
JGI: 53807
UniProt: C7Z317
Position
12
AA seq 723 aa AA seqDB search
MVILTSFRQSPTYLYVKTYCLCALVTLFQATPVTSRLHLANQAPRLRSHGILTTKPSPHR
IPRYRDQAGNIVHSSAKSSVTRSSWRRAAHIVERWYGRAVDLAQVKALLKRDDQDLKTYP
ELQWEAQVRNGSSLHHRERGFIELRKRKISSAGDDSLHRFLALPAGERVDPRDVPLVALG
GSGGGYRAMYGLTGFISAAKKLGLWDCITWVAGVSGSCWTLAAYYTIARHDISRLVQHYL
TVARELAHPMSIPQTSIIGLGIMDLYATLTTTYQLLSREPKGRLSRATFQWSKIWHRSGI
DQGLEPMPILTAVRRVPRFSYGSKQDVYSTCSVKTFRAKGRIKKSQESSAATAPSPAEMA
VDLKPQPKRQFQWFEISPLEIGSPDLNRYIPTWAWGRTFISGHSIDRRPEQSFSLLLGQC
TSAPAGPLTGYISTLLATMAKGTIMARLLSLLNSFLSMKRWEGLWGNPIRAGHDPNPFYG
LERPIRARVHTPQGSLHGPERAKLHHEKDVVCDGVRSMADVPAVEHSIADVPWEAQGRTR
LMDSGMSNNLPNHVLAREERGVDIFIAFDASSDVRTGAAIQRLHQFAADFHIELGEETEI
FHKPEQDIDSSSEGITSHGSEIDSRQMNHYAKVFRGTRRNGQNIYVIYCPLLPNDVNLGF
DPSTASFSTSYNLMWTPDQIRGLLTTSEANVCLHAVHTIRRVMRKVYEDKKAHRLALGVE
TTG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcctgacgtcctttcgtcaatctcctacttacttgtacgtcaagacttattgt
ctgtgtgctctggtcactttattccaagccacgccagttacttcaaggttgcatctcgcc
aatcaagcacctcggcttcgtagccacggtatcttgacaacaaagccaagcccgcatcgc
atacccagatatcgagaccaagctgggaatattgttcacagcagtgccaagtcttcagtt
acaagaagttcttggagacgagccgctcatatagtcgaaagatggtatggcagagcagtt
gacctcgctcaggtcaaggcacttctgaagcgggatgatcaagatctaaaaacatacccg
gaacttcaatgggaggcccaagtccgaaatgggtcttctctgcatcacagagagcggggt
tttatcgaattacgcaagcgaaagatatcatcggcaggcgacgactcacttcatcgcttt
ctcgccctccctgcaggcgagagagttgaccccagagatgttccccttgtggcccttggc
ggctctggaggaggctatcgagccatgtacggactcactggcttcatctcggcagcgaaa
aaacttggactatgggactgcattacctgggttgcaggagtaagcgggagttgctggacg
cttgcggcctactacactattgctcgccatgatatctcaaggcttgtgcaacactatctc
actgttgcacgcgaactggcacatccgatgagtatcccccagaccagcatcatcggactg
ggcatcatggacctctatgccacgttgacgacgacctaccagctgctgtctcgagaaccc
aaggggaggctgagtcgggctaccttccaatggtcaaaaatctggcatcgttctggaatc
gaccagggactcgagcccatgcccattctcacagctgtcagacgcgtgccgaggttctca
tacgggtcgaaacaggatgtttactcgacctgttctgtcaagacattccgtgccaagggg
aggataaaaaagagtcaagagagctccgcggctactgctccttcaccagcagagatggct
gttgatcttaagccccaacctaaacgacaatttcagtggttcgagatttcacctctcgag
atcggaagcccagatctcaatcgatacatccccacatgggcatggggccgcacgttcata
tcaggccactcgatcgatcgacgcccggagcagtcgttctctctgctgctaggtcaatgc
acaagtgcccctgcagggcccttgacgggatatatatcgactctgctagcgactatggca
aaagggaccataatggcgagactgctgtcccttctcaacagctttctgagcatgaagaga
tgggagggcctttggggaaatccgatccgagcaggtcacgacccaaaccccttttatggc
cttgaacggccaattcgagcaagggtccacactccccaggggtctctgcacggtccagaa
agggcaaagcttcatcatgagaaggacgttgtttgtgatggtgttcgctcaatggctgat
gtcccagcggtagaacactcaatcgctgacgtaccatgggaggcccaaggacgcactcga
ctgatggatagcggcatgtcgaataaccttcctaatcacgtcttggctcgagaagagcga
ggtgtcgacatctttattgcctttgatgcttcatcggatgttcgtacaggagcagcgatt
caacgcttgcatcaatttgcagccgactttcacattgagcttggagaggaaacagaaata
ttccataagccagagcaagatattgattctagctcagagggcatcaccagtcatggctcg
gagatagactcgagacaaatgaaccactacgccaaagtctttcggggaacaaggcgaaac
ggccagaacatttatgtcatttactgtccacttttgccaaacgacgtaaatctaggtttc
gatccttcgacggcgtctttttctacgtcgtacaatctcatgtggacaccagatcagatc
aggggcttgctaacgacctcagaggcaaatgtttgcttgcatgcagttcacacaatcaga
cgggtgatgagaaaggtctacgaggataagaaggcgcatcggctagccttgggagttgag
acgacgggctag

DBGET integrated database retrieval system