KEGG   Nectria haematococca: NECHADRAFT_53858Help
Entry
NECHADRAFT_53858  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nhe  Nectria haematococca
Pathway
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_53858
   00500 Starch and sucrose metabolism
    NECHADRAFT_53858
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NECHADRAFT_53858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 DUF4411 BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 9671453
NCBI-ProteinID: XP_003047364
JGI: 53858
UniProt: C7Z2F2
Position
12
AA seq 573 aa AA seqDB search
MTVKSCVPRPRWHPSPTYHLKAPQGWINDPCAPGFDTSTGTYHLSYQWNPNSCDWGDIAW
GHFTSSDGLHWKHNGDRPILEPSESYDDKGIFTGCFYPTGLRGEKGQLTVVYSSITNLPI
HWTLPYARNCAGLAVATSDDGGKTWKKSEKNPILHGEPEGLDVIGFRDPFLTECPALDEL
RGEKSLYGFMSGGLVKGGPTVFLYAVAPDDLTKWTYLGPFVDVPTGFRPSGRWSGDFGVN
WECVNYMTLHNESEEAQFLLMGTEGGEKPGVKDRSGVWSLWMAGALENTSEGPKMKHDYS
GILDHGCLYAPNSYEHPVTKSRIVWGWLKEDELTLPRRESKGWTGYFSLPRELFLYTAEN
VTRGLKSSLEDIQCVKIMDDGSQGKAKRVQTLGIRPLPNIESLRLGEPAFWSHLATKNKS
GKLLETQSVSWELEATINISAAQQRLGFWIRHDKDATQKTAIYFSPEKEEIVVDRVESNQ
EADIKKDEVSGPFTLFYLDRNGSEELEKLRLRIFCDGDIVEVFANDRFALSTMVYADSKE
CTGISWFVEGEGSEETVFESIKLWENMSEVIVS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaaaagctgtgtcccccgcccgcggtggcacccatctccgacttatcatctc
aaagctccccaaggctggatcaacgacccttgcgctccgggttttgatacctcgacaggc
acatatcatttgtcataccaatggaacccgaactcgtgtgactggggcgatatcgcctgg
ggacactttacaagctcggacggtctgcactggaagcataatggggaccggccgatcctg
gaaccttcagagtcttacgacgacaagggaatcttcacaggatgcttctatcccacgggt
ctgcggggagagaagggacagttgacagtggtgtactcatccatcaccaaccttcccatc
cactggaccctgccatatgctcgcaactgcgctggtctggcagtagcaacgtcagatgat
ggaggtaagacatggaagaagagcgagaaaaatcccattctccatggtgagcccgagggt
ctcgacgttataggcttccgggacccttttcttacagaatgtcctgccctggacgagctt
cggggagaaaagagcttatacggctttatgtccggaggtcttgtcaagggcggacctaca
gtatttctatacgctgtcgcaccagatgacttgaccaagtggacctatctcggtcccttt
gttgatgttccaactggcttccgcccatctgggcgctggagtggtgacttcggcgtcaac
tgggaatgtgtcaactacatgacacttcataatgagtctgaagaggctcagttcctactt
atgggaaccgagggtggagagaagcctggtgtcaaggatagaagtggtgtttggtccttg
tggatggccggcgcactcgagaacacctcagaaggtcccaagatgaagcatgactatagt
ggcattctggaccacggttgtctttatgcaccaaactcatacgaacaccctgttacaaaa
agcagaatcgtttgggggtggctcaaggaagatgagttgaccttgcctcgtcgagagtca
aagggctggactggttacttctccctgccacgggagctcttcttgtatactgccgagaat
gtcaccagagggctcaagtcgtccttggaagacattcagtgcgtcaagataatggacgac
ggcagtcaaggaaaggcaaagagggttcaaacacttggaatacggcccctccccaacatt
gaatcactcaggctgggtgaacccgccttttggtctcacttggctaccaagaacaagagc
ggaaagctgttggaaacgcagtctgtcagctgggagttggaggccaccatcaacatctcg
gcagctcaacaacgtcttggcttctggatccgtcacgacaaggacgcgactcagaagact
gccatctacttctcgcctgaaaaggaggagattgtagtcgacagggttgagtctaaccaa
gaggcagacatcaagaaggatgaagtctcggggccctttactctgttttacttggatagg
aacggatccgaagagcttgagaagttgcgacttcgcatcttctgcgatggcgatattgtt
gaggtctttgccaacgatcgctttgccttgtcgaccatggtgtacgccgactcgaaggag
tgcacgggtatcagttggtttgtcgaaggcgagggctcagaggaaacggtctttgagtct
attaagttgtgggaaaatatgtctgaagtgattgtatcgtaa

DBGET integrated database retrieval system