KEGG   Nectria haematococca: NECHADRAFT_54871Help
Entry
NECHADRAFT_54871  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nhe  Nectria haematococca
Pathway
nhe00020  Citrate cycle (TCA cycle)
nhe00640  Propanoate metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_54871
   00640 Propanoate metabolism
    NECHADRAFT_54871
Enzymes [BR:nhe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     NECHADRAFT_54871
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NECHADRAFT_54871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 9669619
NCBI-ProteinID: XP_003043476
JGI: 54871
UniProt: C7ZDW9
Position
13
AA seq 307 aa AA seqDB search
MTLKLLKATINARDTIEYGTNVVGGVSPGKGGQTHLDLPVFSTVQEAMAEVKPHVSAVFV
PAQFAAKAIIESIEAEVPLVVSVAEHVPVHDMLRVHEILRTQSKTRLVGPNCPGIIAPEQ
CRVGIMPYKQYTRGCVGIVSKSGTLSYEAVGSTSRAGLGQSIVVGMGGDMLPGTTLADGL
RLFFEHEETKGIIVIGEIGGEAELEAADLIKEYRKTANPKPVVAMVAGRTAPEGKTMGHA
GAVFSAGDITAGAKAKALEDAGAIVVAHPGVMGETMRELLGILEAPTFEYYLVSQTYEPT
NAEARLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacactgaaacttctcaaggcaacaataaacgcaagagatactatagaatacggtacc
aatgttgtcgggggtgtctccccgggcaagggaggccagacacatcttgaccttccagtc
tttagtactgtccaagaggccatggctgaggttaagcctcacgtcagcgccgtttttgtc
cctgctcagttcgccgccaaggccataatcgaatccatagaagccgaggtacccctcgtt
gtctcggttgcggaacatgtccccgtccatgacatgctccgcgttcatgagattctgaga
acgcagtctaaaactcgtctggttggaccaaattgtccaggcatcattgcaccggagcag
tgccgggttggcattatgccgtacaagcagtataccagaggctgtgtgggtattgtgtcc
aagtcgggcacactcagttatgaagcagttgggtcgacttcacgagcagggctcggccaa
agcatagtagttggaatgggaggcgatatgctgccaggcacgaccttggccgatggtctc
agattattctttgaacatgaggaaacaaaaggcatcattgtaattggtgagattggtggc
gaagctgagcttgaggctgccgacctcatcaaagagtaccgcaagacggccaacccaaaa
ccggttgtggccatggtggctgggcgaacggccccggagggcaagacaatgggacacgct
ggagcagtattttcggcaggagatatcacggcaggggccaaggcaaaggcccttgaggat
gctggagctattgtagttgctcatccaggcgtcatgggcgagacgatgagagagcttctc
ggtatcttggaagctcccacgtttgagtactatctggtctcccagacgtacgaacctaca
aacgcagaagccagacttcgc

DBGET integrated database retrieval system