KEGG   Nectria haematococca: NECHADRAFT_55523Help
Entry
NECHADRAFT_55523  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nhe  Nectria haematococca
Pathway
nhe00350  Tyrosine metabolism
nhe00360  Phenylalanine metabolism
nhe00380  Tryptophan metabolism
nhe00901  Indole alkaloid biosynthesis
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_55523
   00360 Phenylalanine metabolism
    NECHADRAFT_55523
   00380 Tryptophan metabolism
    NECHADRAFT_55523
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    NECHADRAFT_55523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhe04147]
    NECHADRAFT_55523
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NECHADRAFT_55523
    4.1.1.105  L-tryptophan decarboxylase
     NECHADRAFT_55523
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_55523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9675972
NCBI-ProteinID: XP_003041246
JGI: 55523
UniProt: C7ZKC6
Position
16
AA seq 503 aa AA seqDB search
MDLEGFREAARSSIDEIVGYYQNIVDRRVVSSVKPGYLRELVPSKPPVEGEQWKDIQKDV
EAKIMPGITHWQSPNFMAFFPCSSSFPGMLGEMYSSAFNGSAFNWICSPAVTELETIVTD
WLADMFNLPETYRSSGSTLGGGVIHGTASEAILTVMVAARDKYLREATEGVPEDQLDDAM
ADARNKLVAFGSATTHSSTKKAAQVSGVRFMEIPVSAKNNFALTGADVKAAVEKAHAKGL
TPFYLTATLGTTDCCAYDDFESIADALQEVAPPGKGEVWVHVDAAYAGAALVCPEYHHHC
FHRFHSFNMNLHKWLLTNFDCSVTFVQKRSYYIDAFNMTPPYLRNNYSESGLVTDYRDWQ
IPLGRRFRSLKVWFVIRTFGVKGLQEHIRKGIRHGDLFTQLVKDRSDLFEIVAVPRFALV
VLRLKGARSDDQNALTEKVYTTINEEGKIYLTSTVLDGSIYAIRFCLSTPFVEEVHVRDA
FDTLVKTTEMVSGALKGLNAAKL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctggaaggcttcagggaagcagcgaggtcgtccattgacgagattgtaggatac
taccagaacatcgtcgatcgtcgagtcgtttccagcgtcaaaccaggctacctacgcgaa
ctggttccctctaagcctccagtcgaaggtgaacaatggaaggacatccagaaagacgtg
gaagccaagatcatgcccggcatcacgcactggcagtcgcccaactttatggcattcttc
ccatgctcctctagctttcccggaatgcttggagaaatgtactcgagtgcgttcaacggc
tctgccttcaattggatctgctcccctgccgtcaccgagctcgagaccattgtaacagac
tggcttgccgacatgttcaacctgcccgagacctaccgatcctctggcagtactctcgga
ggcggcgttatacacggtacggcatccgaggctattcttactgtcatggtggcagcccgc
gacaagtacctgcgagaagcaaccgagggcgtacctgaagaccagctcgacgacgccatg
gccgatgcgcggaataagctggtagcctttggcagcgctacgacgcattctagcactaag
aaagctgcccaggtctctggcgtccggttcatggaaatccccgtgtcggccaagaacaac
tttgctttgaccggtgccgatgtgaaggccgccgtggagaaggcccacgccaaggggctt
acgccgttctacttgaccgcaacccttgggacgacagactgctgtgcctacgacgacttt
gagtctattgcggatgctctgcaagaggttgccccgcccggtaagggagaggtttgggtc
cacgtcgatgcggcctatgctggtgctgcgcttgtctgccccgagtatcaccaccattgt
ttccaccggtttcacagcttcaacatgaatctgcacaagtggctgctgacgaacttcgat
tgctccgtcacctttgtccagaagcggagctactatattgacgccttcaacatgactccc
ccgtatctgagaaacaactactcggagagcggcttggtgactgattaccgcgattggcag
attcccctcggtcgtcgtttccgaagcttgaaggtgtggtttgtgatccggacatttggc
gtcaagggtctacaggagcacatcaggaagggaatccgccatggtgatctctttacacag
ctagtcaaagatcgatcggacttgtttgagattgttgccgtgccacggtttgctctggtt
gtcctcaggctgaagggcgctaggtcggatgaccagaatgcgttgacggaaaaggtgtac
accaccattaacgaggagggcaagatttaccttacgagcacagttcttgatggtagtatc
tatgccatcaggttctgcttaagcacgccattcgtcgaggaggttcacgtcagagatgcg
tttgacacacttgtcaaaacgactgagatggtgtcgggtgcattaaagggattaaatgca
gctaagctctaa

DBGET integrated database retrieval system