KEGG   Nectria haematococca: NECHADRAFT_5758Help
Entry
NECHADRAFT_5758   CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nhe  Nectria haematococca
Pathway
nhe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NECHADRAFT_5758
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NECHADRAFT_5758
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NECHADRAFT_5758
    1.1.1.-  
     NECHADRAFT_5758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N
Motif
Other DBs
NCBI-GeneID: 9669903
NCBI-ProteinID: XP_003043813
JGI: 5758
UniProt: C7ZCT7
Position
9
AA seq 367 aa AA seqDB search
VTGLQYYGKGDIRLEQITSLPCGPDEVRLKVAYCGICGSDIHEFLGGPIFPPQKGETNKY
TGVSLPITMGHEFSGTVIEVGSQVNDITIGQGVAVNPAWDHRHYGADPCGPCKRGRFNTC
DDMTTYGLGAPGGGFCEEVVVKAMNCIPLPDGVSLKVAALSEPLSVAHHCIDISGFKPGQ
TALICGAGPIGLALAAILRVKKASKIIMSEISQSRIAQAPKFGADAVINPLDKGNDGGHP
QPDPVLTTVAHLTEDGVDVAFDATGLQSTLDLCIAATRAGGVIFNVAIHERPLQINLNDL
VKKEKKLMGGICYQNSDFEAVLQILAEGRLNAEDMITSVVPLSNVVNGGFGELINNKSAH
VKILVKP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gttaccggcctgcaatattatgggaaaggggacatccgactggagcagattacctcactt
ccatgtggccccgacgaagtcagactcaaagttgcatactgtggcatctgtggcagcgac
attcatgagttcctcggcgggcccatctttccacctcagaaaggggagacaaacaagtac
accggcgtgagcctaccaatcaccatgggccacgagttctcggggaccgttattgaagta
ggttcccaggtcaatgatatcaccataggccagggggtcgccgtaaacccagcctgggat
catcgccactacggtgccgacccctgcggaccttgcaagagaggtcggttcaacacttgc
gatgacatgacgacgtacgggcttggtgcccctggcggcggcttttgcgaagaagtcgtt
gtcaaggccatgaattgtattcctctgcctgatggtgtcagcctcaaggtggcagcactc
tccgaaccgctgtctgttgcacaccactgcatcgacatatcgggctttaaacccggtcag
acagcccttatatgtggcgctggaccaattggcctggctcttgcggctatattgcgcgtc
aagaaggcttccaagatcatcatgagcgagatttcacagtcccgtatagcgcaggccccg
aagttcggcgctgacgctgtcattaatccgctagacaagggaaatgatgggggacatccg
cagccagacccagtgttgaccactgtggcacatctcacagaagatggtgtcgatgtcgcg
ttcgatgccacgggtctgcagtcaactcttgatctgtgcattgctgctaccagagcaggg
ggggtcatcttcaatgttgccattcacgagaggcctttgcaaatcaacttgaacgacctt
gtaaagaaggaaaagaagctcatgggtggaatttgctaccagaatagcgactttgaagcc
gtgttgcaaatcttggcagaaggcaggctcaacgcagaggatatgatcacatccgttgta
ccgctatccaacgtggtgaatggagggtttggtgagctgatcaataataaatcagctcat
gtcaagattctagtcaaacct

DBGET integrated database retrieval system