KEGG   Nectria haematococca: NECHADRAFT_59012Help
Entry
NECHADRAFT_59012  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
nhe  Nectria haematococca
Pathway
nhe04113  Meiosis - yeast
nhe04138  Autophagy - yeast
Module
nhe_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    NECHADRAFT_59012
  Cell growth and death
   04113 Meiosis - yeast
    NECHADRAFT_59012
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NECHADRAFT_59012
Protein kinases [BR:nhe01001]
 Serine/threonine kinases: AGC group
  PKA family
   NECHADRAFT_59012
Messenger RNA biogenesis [BR:nhe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     NECHADRAFT_59012
Chromosome and associated proteins [BR:nhe03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    NECHADRAFT_59012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 9663901
NCBI-ProteinID: XP_003052559
JGI: 59012
UniProt: C7YLW9
Position
3
AA seq 393 aa AA seqDB search
MAATVAPSHAGGLPSSSGIPAPPHPHDAADASAGSQDVAGGVSPLPPTRKFQLRDFRRVR
TLGTGTFARVCLVRPAASAHIPLDHQLNPEVYALKILRKPEVIRLKQVDHVRHERAILAD
VAGHPFITQLIASFSDHDSLYMLLDYVPGGELFTYLRKLRRFDEPVARFYAAEIVLVLEY
LHEQQGGIAYRDLKPENLLLDQDGHIKLVDFGFAKRLGHREDNRPVETYTLCGTPEYLAP
EVIQNKGHTGAVDWWALGILIYEFLTGYPPFWHQNPIEIYKHLCRILEKPVVFPQDPPLS
EDAKDIIRAFCTVDRSRRLGNISGGAARVKAHPFFRETNWDDMLNRRHKGPIQPPVRYPG
DAQCFDVYPEDDGSREPYGGDMAAKYDPYFADF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaccgttgcgccttcgcatgccggcggcctgccgtcctcctcgggcatccct
gcgccgccgcatccccacgacgccgcagacgccagcgcggggtcccaagatgtcgccggc
ggcgtctctccactaccgccaacccgcaagttccaacttcgcgactttcgacgagtgcgc
acgttaggcacaggaacctttgcccgagtctgtcttgtccgtccagcagccagcgcccat
atacccctcgatcaccagctcaaccccgaagtctacgccctcaagatcctacggaaacct
gaagtcatccgccttaagcaggtcgatcatgtccgtcatgagcgcgccatcctcgccgac
gtcgcgggtcatcccttcatcacccagttgatcgcctccttctcagaccacgattccctc
tacatgctcctcgactacgttcccggcggcgagctatttacatacttgcgcaagttgcgc
cgcttcgacgaacccgtcgcccgcttctacgccgccgagatagtcctcgtactagagtat
ctccatgagcagcaaggcggtatcgcctaccgcgacctcaaaccggagaacctcctcctg
gatcaggatggccacatcaaactcgtcgatttcggctttgccaagcgcctcggtcaccgc
gaagacaatcggcccgtcgagacctacaccctctgcggaacccccgaatacctggccccc
gaggtcattcagaacaaaggtcacacaggcgcagttgactggtgggctctgggtattcta
atatacgagttcttaacgggataccctccattttggcatcagaaccccattgagatttac
aagcacctttgcagaatcttggaaaaacccgtcgtcttccctcaagacccgccactctcg
gaagacgccaaagacataatacgcgccttctgcaccgtcgatcgttcccgtcgtctcggt
aacatcagcggcggcgcagcccgcgtaaaggcgcaccccttcttccgcgagacgaactgg
gacgacatgcttaaccgccgccacaagggtccgatacaaccccccgtgcgctatcccggt
gacgcccagtgctttgacgtgtacccagaggacgacggctcgcgggagccctacggcggc
gacatggcggcaaagtacgacccatactttgccgacttttaa

DBGET integrated database retrieval system