KEGG   Nectria haematococca: NECHADRAFT_59608Help
Entry
NECHADRAFT_59608  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_59608
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     NECHADRAFT_59608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 9665039
NCBI-ProteinID: XP_003042895
JGI: 59608
UniProt: C7ZF96
Position
3
AA seq 576 aa AA seqDB search
MSSSVKLAEYLFTRLRQLGVDSIHGVPGDYNLTLLDYVQPSGLRWVGNANELNAAYAADG
YARIKGLGAVVTTFGVGELSAINAIAGAYAEFAPVVHIVGIPVRDAQQSRKLIHHTFNDG
EYRRFAAMHAHVTVYQACLNDPRTSAEQIDEALRQCLLHSRPVYIEVPVDMVAKPLSKER
LGSLIVLPEAQPNKDEDEVLSKIMNRIYSAKQPLIVVDGETRPLRICEDVQALIKNTKWP
TWSMPFGKGLTDETLDNFHGVYKGCFDDQPVQDFYQGSDLVLFFGPHFSNTNSSNYTTIP
KDDAAILFTISGVQIGTRLFRDVSSKNIVSRLVRDLDPKQVPSYTPYPKLPRDILLPIPE
KPTDEILAQDKLWKTLANVIEPGDIILGETGTAGFGVREMAIPQHTRVFTPVTWLSIGYM
LPGAQGAALAQKELIEASKYHGLSSAKTILVIGDGSFQMTVQELATMVRHHLNVVVFLIN
NDGYTIERCIHGRNQEYNDVTPWRYLQAPSFFGAKETTYTGSAKTWRELKEVLEHEGLTT
GKELRMVEIFLDRDDCPKGPLWNYMEAQKNGKGVLN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctgtcaagcttgcggagtacctctttactcgtctacgccaattgggtgtt
gattccatccacggagtcccaggggactacaacctcactctcctcgattacgttcaacct
tcaggcctgcgatgggtcggaaacgccaatgagctcaacgccgcctatgccgccgatggc
tatgcgagaatcaagggactcggagccgtcgtcacaacctttggtgtcggcgagttatct
gcaatcaatgccattgctggcgcatacgccgaatttgctccagtcgtgcatatcgttggt
atcccagtccgggacgctcagcaatctcggaagctgattcaccataccttcaacgatggt
gaatatcgccgcttcgcagctatgcatgcgcacgtcactgtgtatcaggcgtgcttaaac
gaccctcggacaagtgcggagcagattgatgaggctctcagacagtgtctactacacagc
cggcccgtctacatcgaagtccccgttgatatggtggccaagcctctgtccaaggagaga
ctagggtctctaatcgtcctcccggaagcgcagcccaacaaggacgaagatgaggtcctt
tccaagatcatgaacagaatctacagtgcaaaacagcctcttatcgttgtcgatggcgaa
accaggccacttagaatctgcgaggacgttcaggctctcatcaagaacaccaagtggccg
acatggtcaatgcctttcggcaagggtcttacagatgagactctagacaacttccacgga
gtctacaaggggtgttttgatgatcaacccgttcaagacttttaccaaggctcagacctg
gtcctcttctttggaccacatttcagcaacaccaacagcagcaactacaccaccattcca
aaagacgacgccgcaatcctctttaccatcagtggagtacagattggcactcgtttattt
agagatgtgtcatccaagaacatcgtctctcgcctagtgcgcgatctggaccccaaacaa
gtgccatcctacaccccttatcccaagctacctcgcgacatcctcctccctattccggag
aagccgacagatgagattctcgctcaagacaagctgtggaaaactctggcaaacgtcatt
gagcctggagatatcatcctcggcgagactggtactgctggctttggcgttcgagagatg
gccatccctcagcacactagagtgtttacacccgtaacttggctttccatcggttacatg
ctacctggcgcccagggagctgccctcgcacagaaggagcttatcgaagcttccaaatac
cacggtttgtcgtcagccaagaccatcctcgtaattggcgatggaagtttccaaatgact
gtccaagaacttgcaaccatggttcgacatcatctcaacgtcgtcgtcttcctgatcaac
aacgacggctacaccatcgagcgatgcatccacgggcgaaatcaagagtataacgatgtc
acgccctggcgatatctccaagcaccatccttctttggagccaaggagacaacttatact
ggttcagcaaagacttggcgtgaactgaaggaggtgctggagcacgagggactgacaacg
ggcaaggagcttaggatggtggagatctttttggatcgggatgattgtcccaagggacct
ttgtggaattacatggaggcacaaaagaatggtaagggagtgttgaactag

DBGET integrated database retrieval system