KEGG   Nectria haematococca: NECHADRAFT_63620Help
Entry
NECHADRAFT_63620  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
nhe  Nectria haematococca
Pathway
nhe00900  Terpenoid backbone biosynthesis
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
Module
nhe_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NECHADRAFT_63620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nhe01006]
    NECHADRAFT_63620
Enzymes [BR:nhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NECHADRAFT_63620
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NECHADRAFT_63620
Prenyltransferases [BR:nhe01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NECHADRAFT_63620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt YkyB
Motif
Other DBs
NCBI-GeneID: 9665437
NCBI-ProteinID: XP_003050078
JGI: 63620
UniProt: C7YU73
Position
9
AA seq 347 aa AA seqDB search
MAQKTTLQEFNSVYPKLEEALLEHARSYKLPQEQLDWYKRSLEINPLGGKCNRGMSVPDS
VSLLLEKPLSEEQYFQSATLGWMTELLQAFFLVSDDIMDSSITRRGQPCWYRQEGVGMIA
INDAFMLEAAIYTLLKKYFRSHPAYVDLIELFHETTFQTELGQLCDLLTAPEDKVDLDNF
SMEKYSFIVIYKTAYYSFYLPVALALHQLNLATPKNLKQAEDILIPLGEYFQIQDDYLDN
FGLPEHIGKIGTDIKDNKCSWLVNQALAVATPEQRKILEENYGRKDDEKEKVVKKLYDDL
KLEQRYLDYEEKVVGEIRARITNIDESEGLKKTVFEAFLAKIYKRSK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaagactactctccaggagttcaactccgtctaccccaagcttgaggaggct
cttctcgagcatgcgcgctcctacaagctcccccaggagcagcttgactggtacaagcga
tccctcgagatcaaccctctcggcggaaaatgcaaccgcggcatgtctgtccccgactcc
gtctccctcctcctcgagaagcccctctctgaggagcagtacttccaatctgccaccctt
ggctggatgaccgagctcctccaggccttcttcctcgtttcggacgacatcatggactcg
agcatcacccgccgcggccagccctgctggtaccgccaggagggtgtcggcatgatcgcc
atcaacgacgccttcatgctcgaggccgccatctacaccctccttaagaagtacttccgc
tctcaccccgcctacgtcgacctcatcgagctcttccacgagaccaccttccagaccgag
cttggtcagctgtgcgacctgctcaccgcccccgaggacaaggtcgacctcgacaacttt
tccatggaaaagtacagcttcatcgtcatctacaagaccgcctattactccttctacctc
cccgtcgctctggccctccaccagctcaaccttgccacccccaagaacctgaagcaggct
gaggacatcctcattcccctgggcgagtacttccagatccaggacgattaccttgacaac
tttggtctccctgagcacattggcaagattggtaccgacatcaaggacaacaagtgctct
tggctcgtcaaccaggccctcgccgtcgccacccccgagcagcgcaagatcctcgaagag
aactacggccgcaaggatgacgagaaggaaaaggttgtcaagaagctctacgacgacctc
aagctcgagcagcgctacctcgactacgaggagaaggttgtcggcgagatccgcgcccgc
atcaccaacattgacgagagcgaaggcctcaagaagaccgtgtttgaggccttcctcgcc
aagatctacaagcgcagcaagtaa

DBGET integrated database retrieval system