KEGG   Nectria haematococca: NECHADRAFT_65752Help
Entry
NECHADRAFT_65752  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nhe  Nectria haematococca
Pathway
nhe03040  Spliceosome
nhe04141  Protein processing in endoplasmic reticulum
nhe04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    NECHADRAFT_65752
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NECHADRAFT_65752
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    NECHADRAFT_65752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nhe01009]
    NECHADRAFT_65752
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nhe03041]
    NECHADRAFT_65752
   03009 Ribosome biogenesis [BR:nhe03009]
    NECHADRAFT_65752
   03110 Chaperones and folding catalysts [BR:nhe03110]
    NECHADRAFT_65752
   04131 Membrane trafficking [BR:nhe04131]
    NECHADRAFT_65752
   03051 Proteasome [BR:nhe03051]
    NECHADRAFT_65752
   03029 Mitochondrial biogenesis [BR:nhe03029]
    NECHADRAFT_65752
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhe04147]
    NECHADRAFT_65752
Protein phosphatases and associated proteins [BR:nhe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NECHADRAFT_65752
Spliceosome [BR:nhe03041]
 Complex B
  Other components
   Prp19 complex
    NECHADRAFT_65752
 Complex C
   Prp19-CDC5 complex
    NECHADRAFT_65752
Ribosome biogenesis [BR:nhe03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    NECHADRAFT_65752
Chaperones and folding catalysts [BR:nhe03110]
 Heat shock proteins
  HSP70 / DNAK
   NECHADRAFT_65752
Membrane trafficking [BR:nhe04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    NECHADRAFT_65752
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    NECHADRAFT_65752
Proteasome [BR:nhe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    NECHADRAFT_65752
Mitochondrial biogenesis [BR:nhe03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    NECHADRAFT_65752
Exosome [BR:nhe04147]
 Exosomal proteins
  Proteins found in most exosomes
   NECHADRAFT_65752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA Actin
Motif
Other DBs
NCBI-GeneID: 9674654
NCBI-ProteinID: XP_003053706
JGI: 65752
UniProt: C7YHX6
Position
1
AA seq 655 aa AA seqDB search
MGPAVGIDLGTTYSCVGIFREDRCDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQVAMN
PTNTVFDAKRLIGRKFADPEVQADMKHFPFKIIDKGGKPIIEVEFKGEQKTFTPEEISSM
VLTKMRETAESYLGETVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKIEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFV
NEFKRKHKKDLSTNVRALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARF
EELCQDLFRSTIQPVDRVLGDAKIDKSLVHEIVLVGGSTRIPRVQKLITDYFNGKEPNKS
INPDEAVAYGAAVQAAILSGDTSSKATNEILLLDVAPLSLGIETAGGMMTKLIPRNTTIP
TKKSEVFSTFSDNQPGVLIQVYEGERQRTKDNNLLGKFELTGIPPAPRGVPQIEVTFDLD
ANGIMNVSAVEKGTGKSNKIVITNDKGRLSKEDIERMLSDAEKYKEEDEAEGRRVAAKNG
LESYAYSLRNTLSDPKVEEKIEAGDKDKLKTEIDKVVEWLDDNQQATREEYEEHQKELEG
IANPIMMKFYGSGGEGGMPGGMPGAGGPGGFPGAGGPGGAPGHGGDDGPTVEEVD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgccgtcggtatcgatttgggtaccacgtactcttgcgtgggtatcttccgt
gaggaccgatgcgacattatcgccaacgaccagggtaaccgaaccactccctctttcgtc
ggtttcaccgacaccgagcgtctgatcggtgatgccgccaagaaccaggttgccatgaac
cccacgaacactgtcttcgatgccaagcgtttgatcggtcgcaagttcgccgaccctgag
gtccaggccgacatgaagcacttccccttcaagatcatcgacaagggtggcaagcctatc
atcgaggttgagttcaagggcgagcagaagaccttcacccccgaggagatctcctccatg
gttctcaccaagatgcgagagaccgccgagtcttacctcggtgagaccgtcaacaacgct
gtcgtcaccgttcctgcctacttcaacgactctcagcgtcaggctaccaaggatgccggt
ctcattgctggcctcaacgttctccgaatcatcaacgagcctaccgccgctgccattgcc
tacggtcttgacaagaagatcgagggtgagcgcaacgtcctcatcttcgatctcggtggt
ggtaccttcgatgtttctctcctgaccattgaggagggtatcttcgaggtcaagtctact
gccggtgacactcacttgggtggtgaggatttcgacaaccgtctggtcaaccacttcgtc
aatgagttcaagcgcaagcacaagaaggatctctctaccaacgtccgtgctctccgacgt
ctccgaaccgcttgcgagcgtgccaagcgaaccctttcttcttccgctcagacctccatc
gagatcgactctctcttcgagggtattgatttctacacctccatcaccagagcccgtttc
gaggagctctgccaggatctcttccgatccaccatccagcccgtcgaccgtgtcctcggt
gacgccaagatcgacaagtcccttgtccacgagatcgttctcgtcggtggatctacccgt
atcccccgtgtccagaagctcatcaccgactacttcaacggaaaggagcccaacaagtcc
atcaaccccgatgaggctgttgcctacggtgccgctgtccaggccgccattctgtccggt
gacacttcttccaaggccaccaacgagatcctgcttctcgatgtcgccccgctttccctc
ggtatcgagactgctggtggcatgatgaccaagctcatcccccgcaacaccaccatcccc
accaagaagtccgaggtcttctctaccttctccgacaaccagcctggtgtcctcatccag
gtctacgagggtgagcgccagcgcaccaaggacaacaaccttctcggcaagttcgagctc
accggtatcccccctgccccccgtggtgttccccagattgaggtcactttcgatcttgat
gccaacggtatcatgaacgtctctgccgtcgagaagggcaccggcaagtccaacaagatt
gtcatcaccaacgacaagggccgtctctccaaggaggacatcgagcgcatgctttcggat
gccgagaagtacaaggaggaggatgaggctgagggccgccgtgtcgctgccaagaacggt
cttgagtcctacgcttactctctccgcaacactctctccgaccccaaggtcgaggagaag
attgaggctggcgacaaggacaagctcaagaccgagattgacaaggtcgttgagtggctc
gacgacaaccagcaggctactcgtgaggagtacgaggagcaccagaaggagcttgagggt
attgccaaccccatcatgatgaagttctacggctccggcggcgagggtggcatgcccggt
ggcatgcccggcgctggcggtcccggtggcttccctggtgctggtggccctggtggtgcc
cctggccacggtggcgatgacggtcctaccgtcgaggaggtcgactaa

DBGET integrated database retrieval system