KEGG   Nectria haematococca: NECHADRAFT_67302Help
Entry
NECHADRAFT_67302  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
nhe  Nectria haematococca
Pathway
nhe00051  Fructose and mannose metabolism
nhe00520  Amino sugar and nucleotide sugar metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NECHADRAFT_67302
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_67302
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NECHADRAFT_67302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 DUF4954 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 9663922
NCBI-ProteinID: XP_003053081
JGI: 67302
UniProt: C7YM04
Position
3
AA seq 364 aa AA seqDB search
MKGLILVGGFGTRLRPLTLTLPKPLVEFGNKPMIVHQIEALVAAGVTDIVLAVNYRPEIM
EKFLAEYEEKYNINIEFSVESEPLDTAGPLKLAESILAKDDSPFFVLNSDVICDYPFQDL
LAFHKNHGAEGTIVVTKVEEPSKYGVVVHQPGHRTLIDRFVEKPVEFVGNRINAGMYIFN
TSILDRIELRPTSIEKETFPAMVRDNQLHSFDLEGFWMDVGQPKDFLSGTCLYLSSLTKR
GSKELTPPTEPFVHGGNVMIHPSAKIGKNCRIGPNVTVGPDVVIGDGVRLQRCVLLRGSK
VKDHAWVKSTIVGWNSTVGRWARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKANVDIP
AIIM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacttattcttgtcggtggcttcggcactcgccttcgccctctcaccctcacc
ctccccaagcctcttgtcgagttcggcaacaagcccatgatcgtgcaccaaatcgaggcg
ctggtcgcagctggcgttactgacatcgtgctcgctgtcaactaccgacccgagatcatg
gagaagttcctggccgagtatgaggaaaagtacaacatcaacattgagttctctgtcgag
tctgagcccctcgacaccgccggacccctgaagctcgcagagtccatcctcgccaaggac
gactcccccttcttcgtcctcaactcggacgtcatctgcgattaccccttccaggacctc
ctggccttccacaagaaccacggagccgagggtaccatcgtcgtcaccaaggtcgaggag
ccctccaagtatggtgttgttgtccaccagcccggccaccgcacgctgatcgaccgattc
gtcgagaagcccgtcgagtttgtcggcaaccgcatcaacgctggcatgtacatcttcaac
acctccatcctcgaccgtatcgagctccgcccgacttcgatcgagaaggagaccttcccc
gccatggtccgcgacaaccagctgcactcgttcgacctcgagggcttctggatggacgtt
ggtcagcccaaggatttcctcagcggtacatgcctgtacctctcctcgctcactaagcgg
ggtagcaaggagctcactccccccaccgagcccttcgttcacggtggcaacgtcatgatt
cacccctcggccaagattggcaagaactgcagaatcggacccaacgtcactgttggcccc
gatgttgttattggcgacggtgtccgtctgcagcgatgtgtgctgctccgcggatccaag
gtcaaggaccacgcctgggtcaagtccaccatcgttggctggaacagcactgttggccga
tgggctcgcctcgagaacgtgacagtcctgggcgacgacgtgacaatcggtgacgagatc
tacgtcaacggtggcagcgtcctccctcacaagtcgatcaaggccaacgttgacatcccc
gccattatcatgtga

DBGET integrated database retrieval system