KEGG   Nectria haematococca: NECHADRAFT_67357Help
Entry
NECHADRAFT_67357  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nhe  Nectria haematococca
Pathway
nhe00450  Selenocompound metabolism
nhe00970  Aminoacyl-tRNA biosynthesis
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NECHADRAFT_67357
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NECHADRAFT_67357
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nhe01007]
    NECHADRAFT_67357
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nhe03016]
    NECHADRAFT_67357
Enzymes [BR:nhe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NECHADRAFT_67357
Amino acid related enzymes [BR:nhe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NECHADRAFT_67357
Transfer RNA biogenesis [BR:nhe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NECHADRAFT_67357
 Prokaryotic type
   Other AARSs
    NECHADRAFT_67357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 9663946
NCBI-ProteinID: XP_003052595
JGI: 67357
UniProt: C7YM50
Position
3
AA seq 666 aa AA seqDB search
MGSKAPILPEEGKRNILITSALPYVNNIPHLGNIIGSVLSADVFARYCRARGHNTIYICG
SDEYGTATETKALEEGLSPADLCAKYHALHKGVYDWFRIDFDIFGRTPTDQQTQIVQQIF
SDLWKNGLIEERETTQPFCADPAHCKFLADRFVEGECSICHDLGARGDQCDACGGLLDPF
EPEREPSNDDDDHVEAKATGWLINPRCKVDGTAPEKRRTKHLYLRLDAIKDLLVPWFHKS
SKEGDWSANCISITQAWIDKGLLPRGITRDLKWGVPIPKGLDGLSDEEYAEKVFYVWFDA
CIGYVSITKNLTDPGNLDGTNWEKWWKNPENVKLYQFMGKDNVPFHTIIFPASQLGTGEN
WTKVHKMSTTEYLNYEGGKFSKSRGVGVFGNTAKETGVDPDVWRYYLLSRRPETADSEFK
WPEFIDANNNDLLKNLGNLNQRILKFCQAKLDGVVPDYTKYTDERLEAHKKEVNEALQTY
ITQFDAIKLRAGLATVMHISALGNKLLQDSKLNNQLLAEEPDRCAAVIGLGINHLQLLAS
IIHPYMPSTGEAILEQIGSPGLISIPETWTGDLIKPGQKIGEPKLLFTQIPASKLDEWRE
AFGGEEIKKQKALEAEKAAAKKAAKEKKKQKKLAIRAAEKEGSASTEKPVEASAVDLLPD
NKPEEK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgggttccaaagcccccattctccccgaagagggcaagcgcaacatcctcatcaccagc
gccttgccctacgtgaacaacatcccccacctgggcaacatcatcggcagtgtcctgtcg
gccgacgtttttgctcgctactgcagagcccgcggtcacaacactatctacatctgcggc
tccgacgagtacggtaccgctaccgagaccaaggccttggaggagggcctctcccccgcc
gacctgtgcgccaagtaccacgcccttcacaagggagtctacgactggttccgaatcgac
tttgacatcttcgggcgaacaccgaccgaccaacagacccagattgtccagcagatcttt
tctgatctctggaagaacggcctcatcgaggagcgcgagactacacagccattctgcgcc
gaccccgcccactgcaagttccttgctgatcgtttcgtcgagggagagtgcagcatctgc
cacgatcttggtgctcgcggagaccaatgtgatgcctgcggtggacttttggaccctttc
gagcccgaacgtgagcccagcaacgacgacgacgaccatgttgaggccaaggcgactggt
tggctgattaacccccgatgcaaggtcgacggtaccgcccccgagaagcggagaaccaag
cacctctacctgcgcctggacgctattaaggatctgctcgtcccatggttccacaagagc
agcaaggagggcgactggagcgcaaactgtatctctatcacccaggcatggatcgacaaa
ggtctgctcccccgtggcatcacccgagatctcaagtggggtgttcctatccccaagggt
cttgatggactcagcgacgaggagtacgccgagaaggtcttttatgtctggttcgatgcc
tgcattggctacgtctcgattaccaagaacttgacagaccctggcaacctggacggtacc
aactgggagaagtggtggaagaaccccgagaacgtcaagctctaccagttcatgggcaag
gacaatgtgcccttccacaccatcatcttccctgcctctcagcttggaaccggagagaac
tggaccaaggtccacaagatgtcgacgactgagtacctgaactacgagggtggcaagttc
agcaagtcccgcggtgtcggtgtgtttggcaacactgccaaggagactggcgttgacccc
gatgtctggcgatactaccttctgtcgagacggcccgagacagccgattccgagttcaag
tggccagagtttattgacgccaacaacaacgacctcctcaagaacctgggtaacctgaac
cagcgaatcctcaagttctgtcaggccaagctggatggtgttgtgcctgactacaccaag
tacacggacgagcgtctggaggcgcacaagaaggaggtcaacgaggctctgcagacctac
atcacccagtttgatgccatcaagcttcgtgctggcctcgctaccgttatgcacatctct
gctctcggaaacaagcttctgcaggacagcaagctcaacaaccagctcctggctgaggag
ccggaccgctgcgccgccgtcatcggtcttggaatcaaccaccttcaactcctcgctagc
atcatccacccttacatgccctctactggtgaggccatcctcgagcagatcggcagccca
ggtctcatttcgatccccgaaacctggaccggtgaccttatcaagccgggtcagaagatt
ggtgagcccaagctcctctttactcagatccccgcgtccaaactcgatgagtggcgtgag
gcttttggtggtgaggagatcaagaagcagaaggccctcgaggcggaaaaggccgcggcc
aagaaggctgccaaggagaagaagaagcagaagaagctcgctatccgtgctgctgagaag
gagggctcagcctctactgagaagcctgtcgaggcctcggctgtcgacctgctccccgac
aacaagcctgaagagaagtag

DBGET integrated database retrieval system