KEGG   Nectria haematococca: NECHADRAFT_67879Help
Entry
NECHADRAFT_67879  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
nhe  Nectria haematococca
Pathway
nhe00350  Tyrosine metabolism
nhe01100  Metabolic pathways
Module
nhe_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_67879
Enzymes [BR:nhe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     NECHADRAFT_67879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin Rib
Motif
Other DBs
NCBI-GeneID: 9664998
NCBI-ProteinID: XP_003043044
JGI: 67879
UniProt: C7ZFF8
Position
3
AA seq 223 aa AA seqDB search
MSDSDYTLYSYFRSSCSARLRIALNIKSIKYDMVYVNLLKNEQLSDEHKALNPSASVPIL
INKASKGTPFKFGQSVAALEYLEEKHPDVPMLPPTSDPEARAMVRTLVDIVCVDIQPPTN
LRIMRRVRELGGSAEDWNLQLMTQGMAAYENVAAGTAGKYSFGDELTLADACLIPAIWNA
ERFGVDLNAFPTITKIVENLKDHPAVVKAHWQNQPDTPENLRA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactctgattacaccctctactcttacttcaggtcttcttgttccgcgcgtctt
cgaatcgctctgaatatcaagtcgatcaaatatgacatggtctatgtcaatctcctcaaa
aacgaacaactttcagatgaacacaaagctctcaacccatccgcctcggtgcccattctc
atcaacaaggcgtcaaaaggcactccattcaagtttggccagtcggtggctgctctagag
tatctggaagagaagcatcccgatgtcccaatgcttccaccaacttctgaccccgaggct
cgagccatggtgcgcacactcgtcgacatcgtctgtgtagacattcaaccacccacaaac
cttcgaatcatgcgtcgagttagagaactcggaggcagtgccgaagattggaatctccag
ctcatgacgcaaggaatggcagcttacgagaatgtggcagcggggacagcgggcaagtat
tcttttggggacgagctgactctggcggatgcttgtctcatcccggctatttggaacgcg
gagaggtttggtgttgacttgaatgccttccctacaatcaccaagattgtggagaatttg
aaggatcatccggctgttgtcaaggcgcattggcaaaaccagccagacactcctgagaat
ttgagggcgtag

DBGET integrated database retrieval system