KEGG   Nectria haematococca: NECHADRAFT_74011Help
Entry
NECHADRAFT_74011  CDS       T01612                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00620  Pyruvate metabolism
nhe00640  Propanoate metabolism
nhe00680  Methane metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_74011
   00620 Pyruvate metabolism
    NECHADRAFT_74011
   00640 Propanoate metabolism
    NECHADRAFT_74011
  Energy metabolism
   00680 Methane metabolism
    NECHADRAFT_74011
Enzymes [BR:nhe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NECHADRAFT_74011
Lipid biosynthesis proteins [BR:nhe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NECHADRAFT_74011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 9677470
NCBI-ProteinID: XP_003049737
JGI: 74011
UniProt: C7YVM6
Position
1
AA seq 665 aa AA seqDB search
MGEVLETQTAPVGGSEAEEWYLPDKMLARHPGRPHIAGLDEYRQMHQLSIQDPDTFWGQQ
ARDLLSWETDFHTVQHGSLSEGNVGWFLGGKLNASFNCVDRHALKDPNKVAIIHETDDGH
GGHSVTYGELLKQVSKVSWVLKDLGVRKGDTVAIYMPMVPEALVAILACARIGAVHSVVF
AGFSAGSLRDRITDAKSKVVITADESQRGGKTIGIKKIVDEALSPLEGVQTLVFKRTGAE
VGWVSDRDHWWHEEVKKWPSYIPPVSMDAEDPLFLLYTSGSTGKPKGILHTTGGYLVGAA
ATGKYVFDIHGDDRYFCAGDVGWITGHTYVVYAPLLLGVSTVVFEGTPTYPSINRYWDII
ANHKITHFYVAPTALRLLKRAGSDPVDHDTSSLRVLGSVGEPIAPEIWKWYFDTIGKGEC
HVVDTYWQTETGSHAVTPLAGVTPTKPGSACLPFFGIDTVLIDPVSGEEIHGNGVEGVLA
FKSSWPSMARTVYGDHQRFQETYLDVYKGYYFTGDGASRDQDGFYWIRGRVDDVINVSGH
RLSTAEIEAAMVEHSAVAESAVVGIADELTGQSVVAFVCLKEAFRANEEAIHLELRLQVR
KNIGPFAAPKNIFVVTDLPKTRSGKIMRRVLRKVVMGEQDQLGDVTTLSDPSVVGKIIDV
VHKGE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggtattggaaactcagacggcgcctgttggcggtagtgaggccgaggaatgg
tatcttcctgataagatgcttgccagacaccctggcaggcctcacattgctggcctcgat
gagtatcgtcagatgcaccagctctccatccaggatcctgataccttttggggacaacag
gctcgagatcttctctcctgggagactgactttcacaccgtccagcatggatccttgtcc
gagggcaacgttggctggttccttggaggcaagctgaacgcatccttcaactgcgtggat
cgacacgccctcaaggaccccaataaggttgctataattcacgaaactgatgatggacat
ggcggccactcggtgacttatggagagctgctgaagcaggtgagcaaggtttcttgggtt
cttaaggatctgggtgtgcgaaagggcgataccgtcgctatctacatgcctatggttcct
gaggccttggttgccattcttgcctgtgctcgcattggcgcagttcactccgtcgtcttc
gctggcttttctgccggatctcttcgagatcgcatcaccgacgccaagagcaaggtcgtc
atcacagccgacgaaagtcagcgaggcggcaagactatcggcatcaagaagattgtcgat
gaggccctaagcccccttgagggtgtccagactttggtcttcaagcggactggtgccgag
gttggctgggtttccgaccgagaccactggtggcatgaagaggtcaagaagtggcctagt
tatatccctcccgtttccatggacgcagaggatccccttttccttctgtatacgtctgga
tccacgggcaagccaaagggtatcttgcatactaccggcggctatctcgtaggagctgcg
gccactggcaagtatgtgttcgacattcacggagatgaccgctatttctgtgctggcgat
gtcggatggattactggccacacctatgttgtttatgcccctctgctcctgggcgtgtcc
accgtcgttttcgagggcacacccacatacccttccatcaaccgctactgggacattatc
gccaaccacaagattacgcacttctacgttgcgcccactgctcttcgacttctgaagaga
gctggatcggatcctgttgaccacgacaccagcagcctccgcgtccttggttcagtcgga
gagcctatcgctcctgagatttggaagtggtatttcgataccattggcaagggtgaatgt
cacgttgttgatacgtactggcaaactgagactggatctcatgctgttacgcccctcgct
ggtgtgacgcctaccaagcccggatctgcttgtttgcccttctttggtatcgatactgtc
ttgatcgaccccgtttctggtgaggaaattcatggaaatggagtcgagggtgtgcttgct
ttcaagtcttcttggcctagcatggctcgaacagtgtacggtgatcaccaaagattccag
gagacatatctggacgtttacaaggggtactatttcaccggtgatggtgctagccgtgat
caggatggcttttactggattcgcggccgcgttgacgatgtcatcaacgtcagcggccat
cgattatccactgctgagatcgaagctgccatggtcgagcactccgcggtcgctgagtct
gccgttgtcggtatcgccgacgagctcactggtcagtccgtggtggcttttgtctgcctc
aaggaggccttcagggccaatgaggaagccattcatcttgaactcaggctgcaagttcga
aagaacattggtcctttcgcggcccctaagaacatctttgtggttactgatctccccaag
actcgatctggaaagatcatgcgtcgtgttctgcgcaaggttgtcatgggcgagcaggat
cagcttggagatgtaactaccctgtcggatccctccgttgttggaaagatcatcgacgtt
gtgcacaagggggagtag

DBGET integrated database retrieval system