KEGG   Nectria haematococca: NECHADRAFT_76536Help
Entry
NECHADRAFT_76536  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nhe  Nectria haematococca
Pathway
nhe00790  Folate biosynthesis
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_76536
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhe04147]
    NECHADRAFT_76536
Enzymes [BR:nhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     NECHADRAFT_76536
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_76536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 9678174
NCBI-ProteinID: XP_003046643
JGI: 76536
UniProt: C7Z4I7
Position
2
AA seq 134 aa AA seqDB search
MAQPRFSAGTDAASVTPALKALLTSDGGRWTLAKDGAALERQFKFKTFAKTWVWHSNVYN
TTFVRWTTHNPAGLSDKDIDMAAQCDTLAAQLGELPPEPVPEAAVEAEGQSCAIRGLADR
AAGAAGDCCTPKSK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccacgattctctgctggcactgatgccgcgagcgtcacgccagctctcaag
gctctgctcacatccgacggcgggcgctggacgcttgccaaagatggtgcggcgctggag
aggcaatttaagttcaagacatttgcaaagacgtgggtgtggcactccaatgtctataac
accacctttgtccgctggacgacccacaacccagccggcctctcagacaaggatatcgac
atggccgcccagtgtgacactctcgccgcgcagctaggcgagctgcccccggagccagtg
cccgaggcggcggtcgaggcggaggggcagagctgcgcgatccggggcctggctgaccgg
gctgctggtgctgcaggggactgctgtacgccaaagagtaaatga

DBGET integrated database retrieval system