KEGG   Nectria haematococca: NECHADRAFT_77788Help
Entry
NECHADRAFT_77788  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nhe  Nectria haematococca
Pathway
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_77788
   00500 Starch and sucrose metabolism
    NECHADRAFT_77788
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NECHADRAFT_77788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 9671142
NCBI-ProteinID: XP_003053120
JGI: 77788
UniProt: C7YM80
Position
3
AA seq 619 aa AA seqDB search
MKPTLLLTAGSLAWAKPSGYKIDYNRAPPNLSTLANYSLFETWRPRAHVLPPFGQIGDPC
MHYTDPKTGLFHVGWLHLGAAGATTDDLVTYHDLNPDGAPFIRAGGTNDPIAVFDGSVIP
SGIDGKPTLLYTSVSYLPIQWTINYTRGSETQSLAVSKDGGRNFTKLHQGPVIPSPPFAL
NVTGFRDPYVFQNSRLDSLLDSKPGTWYNVISGGVHGKGPSVFLYRQHDPEFQYWDYLGE
WWHEKANSTWGEGLWAGRYGFNFEVANIFSLDEEGYNSKGEVFATLGAEWSLDPIVPEVS
DFREMLWAAGNVSVEDGDVKFSPTMVGKLDWGHSAYAAAGKVLPSSSKASSKSGAPDRFI
SYLWLTGDYYGTLKQFPTSQQNWTGSLLLPRELTVGKISNVVDNELAREKGSWRVAKNES
GVVELDTLKQVIAREALSKLTKKKSFTEEGRTISKSGSTAFKRHPKSKFYVLKTSISFPS
SARNSDLKAGFQILASEHESTNIYYQFSNETVLIDRNKTSAAARTTSDIDSRNEAGRLRL
FDVVEKGKDQIETLDLTIVVDNSIVEVHANDRFSLSTWARSWYADSTEIRFFHDGEGEVT
FGDVSIYEGLFDAWPERKR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctacacttcttttgactgctggctccttggcctgggcaaaaccgtccggctac
aagatcgactacaaccgcgcacccccaaacttgtcgacactcgccaactacagtctgttt
gagacatggcgtcctcgagcgcatgtgctccctcccttcggacagatcggagacccttgc
atgcactacaccgacccaaagacgggactcttccacgttggctggcttcaccttggtgcc
gcaggcgccacgacggatgatctggtgacgtatcatgatcttaatcccgatggggctccc
ttcattcgtgcgggcggcacaaatgaccccattgctgtctttgatgggtcggttatcccc
agcggcattgacggtaaaccaacgcttctttacacgtcggtctcctacctacctatccaa
tggaccatcaactacacccggggcagtgagacacagtcactggccgtctcaaaggacggt
ggccgaaacttcacaaagttgcaccaaggtccggtgattccgtcacctccctttgctctt
aatgtgacgggcttccgagacccctacgtcttccagaactctcgcctcgactcgctcctg
gacagcaagcctggaacctggtacaacgtcatctctggcggtgtgcacggaaagggccca
agcgtgttcctctaccgccagcatgacccagagttccagtactgggactacctgggcgag
tggtggcatgagaaggccaattccacctggggtgagggactctgggctggaagatacggc
ttcaactttgaggtcgccaacattttcagcttggatgaggaaggatacaactccaagggc
gaggtctttgctacccttggtgccgagtggtctctcgacccaatcgtacccgaggtgtcg
gactttcgggagatgctctgggcagcaggcaacgtctcggttgaggatggagatgtcaag
ttttcccccacgatggtaggaaaactggactggggtcattctgcctatgccgctgctggc
aaggttctgccatcatcttcgaaagcttcatccaagagcggtgcaccggataggttcatc
agctacctgtggttgactggtgattattatggtacactcaagcagtttccaacttcgcag
cagaattggaccggttcccttctcctgccgagagagttgactgttggaaagattagcaac
gtggtcgataacgagctcgcacgggagaagggttcatggcgcgtggctaagaacgagtcg
ggagttgtggaacttgacacgctgaagcaggtcatcgctcgcgaagcgctgtccaagctg
accaagaagaagtctttcactgaggaaggccgaaccattagcaagtctggatcaacggcc
tttaagcgacatcccaagtccaagttctatgttctcaagacctccatctcgttcccaagc
tcggctcgcaactcggatctcaaggcaggcttccagattttggcttcggaacacgagtcc
accaacatctactaccagttctcaaacgagactgttctcattgaccgtaacaagaccagc
gctgcggcacgcactactagcgacattgactcgcgaaacgaagcaggacggctgcgattg
tttgatgttgtcgaaaagggcaaggaccagatagagactctggacctcactattgtcgta
gacaattctattgtggaggttcatgccaatgaccggttttcgttgagcacctgggctcgt
tcctggtacgctgattcgactgaaatccgtttcttccatgacggagagggcgaagttacg
tttggcgatgtctctatctatgaggggctctttgatgcttggcctgagaggaagcggtag

DBGET integrated database retrieval system