KEGG   Nectria haematococca: NECHADRAFT_85417Help
Entry
NECHADRAFT_85417  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
nhe  Nectria haematococca
Pathway
nhe00680  Methane metabolism
nhe01100  Metabolic pathways
nhe01200  Carbon metabolism
Module
nhe_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NECHADRAFT_85417
Enzymes [BR:nhe01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     NECHADRAFT_85417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-GeneID: 9677626
NCBI-ProteinID: XP_003039905
JGI: 85417
UniProt: C7ZNZ2
Position
10
AA seq 536 aa AA seqDB search
MNHTMNHSNGPSDISRVSGSFLHDPRQLDRVSTLLTSLISKSDKEDHEFSKIKAYVGISL
FKYVMRYGSGNNTYFNRDRLVTSGRYNSKWQDLFMHLFAAEGLAVDPTRLASVLSRTATP
LRHSTQAISNAIGQGIAMKNLAMLYNKPGLELLYNMIWCVIDDANFLQGSTLETVALAGC
WRLNNLCVIYDGIQSARSPSVDVSKLKSHGWNVIELVNDNNLTVTALGAARRSNVPTFVN
IQPPDNSTSHRLPFPPNINTPLPLLLELYDFFQDVSKRSKFYEAEWLVKVKTYEELYPAL
AKEFWNNVAGKNLAKPTNPITPPLSPLPCSRGGKHSSIRRGKPSQRPGRRSTPDGAKSEI
LHVRPCDAEEAAGAFLVSIRSTELPTTISLPQNGTISFPGHSSRLGVTLGAYAFSNCHGE
DFDMTLISAGVGIYYAMGTQDFLLKKYCLKARIVSCPCLKLFQLQTEKYKRSVLQPQSGR
PTVAIDFGNSQGWEPYADALVSLEDGDNGEMGNNQPDKIGPRVRDFVKEFKERKTR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatacgatgaatcacagcaacggaccctcggatatctctcgggtcagtggaagc
ttcttacatgatcctcggcaactcgatagagtctcgacgctgcttacgagtcttatctct
aaatcagacaaagaagaccacgaattttcaaaaatcaaagcctatgtcggaatttccctc
ttcaaatatgtgatgagatatggatcgggtaataatacttactttaatcgtgatcggcta
gtcacatcaggacgttataacagcaaatggcaagacttatttatgcacctctttgcagct
gagggcctcgccgtcgacccgaccagacttgccagcgtcctctccagaacagcaactcca
ttgcgccattcaactcaagcaatctcgaatgccatcggccaaggcattgcaatgaagaac
ctagcaatgctctacaataaaccaggcctggagttgttgtataacatgatctggtgtgtt
attgacgatgccaactttctgcagggtagcactcttgagacagttgccctagctggttgc
tggaggctgaacaacctttgcgtcatctatgatggcattcagagcgctcgaagtcctagc
gttgatgtttccaagttgaagtcgcatggttggaacgtgattgaactggtgaatgacaac
aacctcaccgtcactgctcttggagccgcaagaagaagcaatgtaccgacctttgtcaac
atccaaccgccagacaactcgacgtcccataggcttcccttccctcctaatatcaacact
ccgttacccctccttctcgaactgtacgacttcttccaggatgtaagcaagaggagcaag
ttctatgaggctgaatggctagtcaaagtcaagacatatgaagaattgtatccagcgctt
gccaaggagttttggaacaatgttgccggcaagaatctcgctaagccaacaaaccccata
actccacctctgtcgcccttgccgtgctcccggggaggaaaacacagctctatcaggaga
ggcaagccgtcacaacgaccaggtcgacgctcaacgccagacggagcaaaatccgaaatc
cttcatgtccgcccttgcgacgccgaagaagctgcaggcgcctttctcgtgtctatcaga
tcgactgagttgcccacaacgatttcccttccgcagaatggtaccatcagctttccaggt
cattcatctcgcctgggcgtgacgcttggagcttacgcattctccaactgtcacggggag
gactttgatatgacactgataagcgcgggtgttgggatttactacgcaatgggtacgcaa
gatttccttctaaagaaatattgtctgaaggctaggatagtttcatgtccctgcctcaaa
ctctttcagttgcaaacagagaagtacaagagatctgtccttcagccccagagtgggagg
ccgacagtagcgattgactttgggaatagtcaaggatgggagccatacgcggatgcgctg
gtctcgctggaggacggcgataatggagaaatggggaataatcaacctgataagattgga
ccaagggtcagagattttgttaaagagtttaaagagagaaagactagataa

DBGET integrated database retrieval system