KEGG   Nectria haematococca: NECHADRAFT_92621Help
Entry
NECHADRAFT_92621  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
nhe  Nectria haematococca
Pathway
nhe04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    NECHADRAFT_92621
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nhe04131]
    NECHADRAFT_92621
Membrane trafficking [BR:nhe04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    NECHADRAFT_92621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin zf-RING_5 Vps39_2 WD40_like zf-RING_2
Motif
Other DBs
NCBI-GeneID: 9673388
NCBI-ProteinID: XP_003051641
JGI: 92621
UniProt: C7YPY0
Position
4
AA seq 1366 aa AA seqDB search
MTDQSPQPSHEQEHDPEAQQSKHDPARDEAQTPPVAKSIAPDDNANETNTSEDKEQDSTV
EMKEDDAKDIETGEAGQLSEDPKHGGLSKGSQEEEDNEQEEEDEEEDQDQDQDQDEEDED
DEEDDEDEDEDEDDDDDDDDDDEDDEPRLKYARLTQHLGGVYKNGDATSAFLVAGDKMIV
GTHNGNIHVVQLPIFQSLRVYHAHSASVTSISISPYPPPLPTEKPEGTPRHAAPSNASVS
SRQTESSPAAASRRPREAPQIPKIPSNDIFVATSSMDGNVCVQSLIDMRDVQLRNFARPV
QAVALSPEFRTDRTYLSGGLAGQLILTVGGGPGRSTSTTTGTAAATASGWLGSMGIGSNT
GKDTILHSGEGTISTIKWSLSGKYVVWLNEHGIKIMRSKLHLESADTEDAWKRIGHIDRP
QTDEWETMASVWKGRVEWIDEQSVELDESDQGSLDKALSPAAEKLKEQAVLGKRSIERLL
VGWGGTIWIIHVHPGGVGVGRHAGEKSLGRAEIVKILRMDCIISGISLYTQNLLLVLAYC
LPDDDEDEDEEAGSASPARKHKSTLSTGSEPAGGIRHRQNNQPPELRLINLNSQAEADKD
SLSVSRYERLSSGDYHLGVLPARNAASAIASSRGAFEAIAGLGSDMWNAAINPRALFSSG
ASIRSRESGEDVGSSLRAGSTTGTIRPGSRGGVSSSVHSGLVKPGVKIFIHSPYDCILAT
RRDLSDHLGWLLERQQYQRAWELLDEHPEIMAPITERTSDAVPSTPTRQQGAGDDFYDDE
SAVDSQYRDMYSSAEREKRRIGEMWIQELIEEDDWVSAGKICGKVLKTPDRWEKWVWTFA
GAKKFDAITNYIPTEPMHPRIPSTIYEVVLGHYIQNDKVRFRELLDRWAPELFDIKTITT
ALENQLKYRDVREDSIDDGEKGRDWRIVVESLARLHEANGRQREALKCYIKLHDADSAFR
LIRENHLAEAVADDIPSFMGLRVPSGKLDQMTAEELEEATSEAVTLLVDEAQHGLLRPDI
VVEQLLSQNLNLYIYFYFRGLWRGEGIKEHTGENVDRLVMDSQSLVDNFADLAVHLFATF
DRDLLMQYLKTSVSYTFEKAVHECETFSYYDELVFLYSKTGQMKRALYLIIDRLKNVHKA
IEFAKEQDDPDLWEDLLKYSMDKPSFIRGLLEQVGTAINPITVVRRIPEGLEIEGLREGL
THMMKEHEIQYSISSGVARVLRSEVAAAQNDLRAGQRKGIKFEVMVQESDHVDIEVKDVP
TDPDNPEETKAHPSTDHDHRVPKPGHCARCHEPFTEYEMETLVGYACGHVFHVSHLLEML
HGGKVDIDLGNGAEEGSRYSVGMKVMKARLLKDKVRGGCPVCHVKA
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccagtcgccgcaaccgagccacgagcaggagcacgatcctgaggcccaacaa
tccaagcatgacccggcgcgcgatgaagctcagactcccccagtagcgaagtcgatagct
cccgacgacaacgcgaacgagaccaacacctcagaagataaggagcaagactccacggtg
gagatgaaggaagatgacgcgaaggatatcgagactggggaagccgggcaactgtctgag
gatcccaaacatgggggactaagcaagggtagtcaagaagaggaggacaacgaacaggaa
gaggaagatgaggaagaagaccaagaccaagaccaagaccaagacgaggaggacgaagac
gatgaggaagacgacgaagatgaggacgaggatgaagacgacgacgacgacgacgacgac
gacgacgaggatgatgagcccaggctcaagtacgcgcggttgacccaacatcttggcgga
gtatataaaaatggagatgcgacgagcgcgtttctcgtcgctggggacaagatgatcgtt
ggaacgcataatggcaacattcacgtcgttcaactccccattttccagtcattaagggtc
taccacgcccattcggcatctgtgacttctatttccatatctccatatccaccgccattg
ccaactgaaaagccggaagggacaccacgacatgcggcacccagcaacgccagcgtctcc
agccgtcaaacagagtcatctccggcggcggcatccagaaggccccgtgaagcacctcaa
atcccaaagattccctcgaatgacatctttgtcgccacgtcttccatggacggcaacgtg
tgcgtgcagtcccttatcgacatgagagatgtccaactgcggaatttcgcccggccagtt
caagcggtagctttatcgccagagttcagaacagaccgaacatatctctcaggaggactg
gctggccaactcattcttactgtgggtggtggcccaggtcgaagtacctcaactacgacg
gggactgctgcagccacggcctctgggtggttgggcagcatgggtattggcagcaacact
ggcaaggataccattttgcactctggtgaaggaacaatcagtacaatcaaatggtccttg
tcgggtaaatacgtggtctggttaaacgaacacggtatcaagatcatgcgctcaaagctc
catctcgagagtgcagacacagaggacgcttggaaacggataggacacatcgaccgacca
cagacagatgaatgggagaccatggccagtgtatggaaaggccgagtcgaatggatcgat
gaacaatccgttgaactggacgagtctgatcagggctccctggacaaggccttgtcgcca
gctgccgaaaagcttaaagaacaagctgttttgggcaagagaagcatcgagcgattgctc
gtaggctggggtggaacaatatggattattcacgtccatcctggtggtgttggcgttgga
cggcacgctggtgagaagagtctgggacgggcagagattgttaagatacttcgcatggat
tgcatcatttccggaatttctttatatacccaaaacctgttgctggttcttgcgtactgt
ttaccagatgacgacgaagatgaagacgaagaggccggctcagcatcgccagccagaaag
cacaagtcaaccctctcaacgggaagcgagcctgcaggtggcattcgtcatcggcaaaat
aatcagcctcctgaattgcgtctgatcaaccttaattcccaggccgaagctgacaaggat
agtctcagtgtcagtcgctatgagaggctgtcatcgggcgactatcacctgggtgttttg
cctgcgcgaaacgcagcatcggccattgcctcctcgagaggcgcctttgaggcgatagcg
ggacttggctcggacatgtggaacgccgcaattaatccccgagcactcttcagttccggg
gccagtatccggagcagggagagcggcgaggacgtaggttccagtctcagggcgggaagc
acaacaggtactatccgtcctggctcaaggggtggcgtgtcgtcatcagtccactcagga
ctggttaaaccgggtgtcaagatattcatccacagtccgtatgactgtatccttgctacc
aggcgggacttgagtgatcacctggggtggcttctggagcgtcaacagtaccaacgggct
tgggagcttctggacgaacatcctgaaatcatggctccaatcactgaacggacgagcgat
gctgttccttccacaccaacgaggcaacaaggcgccggcgacgacttttacgatgacgag
tctgccgttgactcgcagtacagggacatgtactcgtcagccgagcgagaaaaacggcga
atcggggaaatgtggattcaggagctcatcgaggaagacgactgggtgtctgctggcaag
atctgtggcaaggtgctaaagacaccggacagatgggagaagtgggtttggacatttgct
ggcgccaaaaagttcgatgccatcacgaactatataccgacggagccgatgcaccctcga
atcccttcgactatatacgaagtcgtgcttggtcattacattcagaatgacaaggtgcgg
ttcagggagttgctcgaccgctgggcacctgagttgtttgacatcaagactatcacaacg
gccttggagaatcagctcaagtaccgggacgttcgtgaagacagcatcgacgatggagaa
aagggacgagactggcggatcgtggtggaaagcctggcaaggctccacgaggccaacgga
cgtcaacgggaggcactaaagtgctacatcaaacttcatgacgctgattcggcattccgt
ctgattagagaaaatcaccttgcagaggcagtcgcggacgacattcccagcttcatggga
ctccgagttccatcaggtaaactggaccagatgacagccgaggagcttgaagaagccaca
tccgaagcagtcaccttgctagtcgacgaggctcagcatggtctcctgcgcccagacatt
gtagtggaacaactactctcccagaacctcaacctatacatatacttctacttccgaggc
ctatggagaggtgagggaatcaaggagcacacaggggagaatgttgacagactggtcatg
gacagtcaatccttggtggacaactttgctgacttggcggtccatctttttgcgacattt
gaccgcgatttactgatgcagtacctcaaaacctctgtctcatacacatttgaaaaggct
gtccatgaatgcgagactttctcatactatgatgaactggtgtttctctactccaagacc
gggcagatgaagcgtgccttgtacctcatcattgaccgactcaagaacgtgcacaaggca
atcgagtttgccaaggaacaagacgaccctgacctttgggaagaccttctcaagtatagt
atggacaagcccagctttatccgtggccttttggagcaggttggtacagcaatcaaccct
attaccgtggtacgacggattccggagggactggagattgaagggctcagggagggcctt
acacatatgatgaaggaacacgagatacaatacagcatcagctcgggcgttgcgcgtgtc
cttcgaagcgaggtggctgcggcacagaacgacctccgggctggacagcgcaagggcatc
aagttcgaggtgatggtccaggaaagcgatcacgtcgatatcgaggttaaggatgttcct
acggacccggacaaccctgaggagaccaaagcccatccttcaacggaccatgaccaccgg
gtgccgaagccggggcactgtgcgagatgccacgagccatttacagagtatgagatggag
acattggttggatatgcgtgtgggcatgtgttccacgtgagccatctcttggagatgcta
cacggaggaaaggtagatatcgatctaggaaacggcgctgaagaggggagtcgatattca
gttggtatgaaggtgatgaaggcgaggctgttgaaggacaaggtgcgaggaggctgccct
gtttgtcatgtcaaagcgtaa

DBGET integrated database retrieval system