KEGG   Nectria haematococca: NECHADRAFT_92807Help
Entry
NECHADRAFT_92807  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nhe  Nectria haematococca
Pathway
nhe00330  Arginine and proline metabolism
nhe00332  Carbapenem biosynthesis
nhe01100  Metabolic pathways
nhe01130  Biosynthesis of antibiotics
nhe01230  Biosynthesis of amino acids
Module
nhe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NECHADRAFT_92807
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NECHADRAFT_92807
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NECHADRAFT_92807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 9673606
NCBI-ProteinID: XP_003051778
JGI: 92807
UniProt: C7YQR0
Position
4
AA seq 398 aa AA seqDB search
MRGNGKSLTIVIKLGTSSIVDEKTHEPLLPILTLIVDTAVKLRKDGHRVVIVSSGAIGVG
LRRMDVEKRPKHLAQLQALAAIGQCRLMSLWDSLFTHLRQPIAQILLTRNDIADRTRYFN
AQNTFNALLEQGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMIHADMLFLMTDVDCLYD
KNPRTNPDAKPIEVVEDISALQADVSSAGSALGTGGMSTKIIAARLGTSAGVTTIITRSS
NPGNVLNIVRYLQPQQKGHSSPSADEGTSHLTRSASALSLSSSADLTSPPLHTRFVPADD
PIRDRHFWLLHTPYPHGTLYIDSGAYKALLGKAGLLPVGVVDVEGNFAQQEVVRLVVVKR
RTTLGPDGKLWDGIPEEIGPSMSPTGNMLASLEETADP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaaacggaaagtccctcaccatcgtcatcaagcttggaacaagctcaattgtc
gacgaaaagactcatgagccgcttctcccaatcttgacgttgattgtcgacacggccgtc
aagcttcgcaaagatggccaccgggtcgtcattgtttcgtcgggcgccatcggcgttggt
ctccgacgcatggatgtcgagaagcgccccaagcatctcgcacagctgcaggccctcgca
gccattggccaatgtcgtttgatgagtctctgggatagcctgttcacccacctgagacag
ccaattgcccagatcctgctcacaaggaacgatattgcagatcgaacaagatactttaat
gctcaaaacaccttcaatgcccttcttgaacaaggagtgatcccaattgtcaacgaaaac
gacaccttggccgtctcagaaatcaagtttggcgacaatgataccctctctgccatcacc
gctgccatgattcacgccgacatgctattcttgatgacggatgtcgactgtctctatgac
aagaatccgcgaacaaacccagacgccaagccgatcgaggtggtcgaagacatctcagct
cttcaggccgatgtatcgagtgccggctcagccctaggcacaggtggaatgagcaccaaa
atcattgccgccagattgggaacctcggctggtgtcacaaccatcatcacccgatcctca
aacccaggaaatgtactgaatattgtccgatatcttcaaccacagcaaaaaggacactcg
tctccaagcgccgacgaaggaaccagtcacttgacacgctcagcttcggccctatccctc
tcctcttcagcggatctcaccagccctcccctgcatactcgattcgtaccagcggatgat
cccatccgagatcgccatttctggctactccacactccatatccccacggaaccctctat
atcgactcgggagcctacaaggcactcctcggcaaggccggcctgcttcctgttggtgtt
gttgacgtggaaggcaactttgctcagcaagaggttgtgcggctcgtggtggtcaagcgt
cggactacccttggccctgacggcaagctctgggatggcatcccagaagagatcggaccg
agtatgtcgcccaccggcaacatgttggcttctttagaagagacagcagacccgtga

DBGET integrated database retrieval system