KEGG   Candidatus Nanopelagicus hibericus: B1s21160_04940Help
Entry
B1s21160_04940    CDS       T05090                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
nhi  Candidatus Nanopelagicus hibericus
Pathway
nhi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nhi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B1s21160_04940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nhi01007]
    B1s21160_04940
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nhi03016]
    B1s21160_04940
   03029 Mitochondrial biogenesis [BR:nhi03029]
    B1s21160_04940
Enzymes [BR:nhi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     B1s21160_04940
Amino acid related enzymes [BR:nhi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   B1s21160_04940
Transfer RNA biogenesis [BR:nhi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B1s21160_04940
 Prokaryotic Type
   Other AARSs
    B1s21160_04940
Mitochondrial biogenesis [BR:nhi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B1s21160_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ASY13656
UniProt: A0A249KA82
Position
complement(960094..961779)
Genome map
AA seq 561 aa AA seqDB search
MSADSVQNKVAQAILKALALAKSSGELNCELPQRLILDRPKNREHGDYATSVALSLAKVA
NNQPRVIAEVIVKTLSDNNLLTPNGISKIEIAGPGFINITLESASQAGVVSEILTLGKKY
GTSSALDGKRINLEFVSANPTGPLHLGHTRWAAVGDSLGRVLAAAGAEVSREFYVNDRGN
QMDLFGQSLRAAALKIAIPENGYHGEYIVDLANEITQANPNFTKLAESDSIAAFRDTGYQ
LQLAQQRKVLENFGTHFDTWFSERTLYENNFFVHILDKLKSLGHVYEADGATWLRTTDFA
DDKDRVMIKSDGSFAYFASDSAYYISKRERGFNLCIYMLGADHHGYVGRIKAIAACAGDN
PEDDVEILIGQMVKIIEGGQELKLSKRAGTIITLEELVEKVGKDAARYTLTRYPTDTPMV
MDVDLLKKNTNENPVYYVQYAHARICAVLRNAKEFKIKFGLNSFSPELLVHERERELIGL
IAQYPKIVAAAAQMRQPHRVARYIEEVAGQFHRFYNDCRVLPLGDEKPGPLNSARASLAM
ATAQVINNGLDLLGVSAPEKM
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagattcggtgcaaaataaggttgcgcaagcaatcctcaaagcgctggcactg
gccaaaagtagcggtgagttaaattgtgaattgccccagcggctaatcctcgatcgacca
aaaaatcgtgagcatggtgattatgcaacttcagtcgccttatctctggcgaaggttgcc
aataaccaaccacgggtgatcgctgaggtgattgtcaaaaccctttcggataacaatcta
ttaacccctaatggaattagtaaaattgagattgccggcccaggatttatcaacataact
ttagaaagtgcaagtcaagcaggtgtagtgagtgaaattcttaccctaggtaagaaatat
gggacttctagcgcacttgatggaaagcgaattaatcttgaatttgttagtgcaaatccc
accggaccattgcatttagggcacaccaggtgggcggcggtgggagattccttaggtcga
gtattagcagctgccggggcagaggtatcaagagagttttatgttaatgatcgcggcaat
cagatggatttgtttggccaatcactacgtgctgcggcgcttaaaattgctatccctgaa
aatggatatcacggtgagtacatagtggatttagcaaatgagattactcaagccaatcct
aactttaccaaattggcagaatcagattcaattgcagcatttagagatactgggtatcag
ctgcagttagcgcagcagcgtaaagttttagagaattttggcacccattttgatacctgg
ttctctgagcgaacactctacgaaaataacttcttcgttcacattttagataaattgaaa
tctttaggccatgtatatgaagcggatggtgctacctggcttcgcacaactgattttgcc
gatgataaggatcgagtaatgattaagtccgacggatcctttgcttattttgcatctgac
tctgcttattacattagcaagcgagagcgcggatttaatttatgtatttatatgcttggc
gcagaccatcatggatatgtgggccggataaaagcaatagcagcctgcgctggcgataat
ccagaggatgatgttgaaatattaattgggcaaatggtgaaaattattgaaggcgggcaa
gaattaaaactttcgaaacgagctggaactattattaccctagaagagttagtagaaaaa
gttggaaaagatgcagcccgatacacattaacaagatatccgactgatacaccaatggtt
atggatgtcgatctgctgaagaaaaatacaaatgaaaatccagtttattacgtgcagtat
gcgcatgctcgaatttgcgcagtacttcgcaatgccaaagagtttaaaattaaatttggt
ttaaactcattttcaccagagttgctggtgcatgaaagagagcgagaattaattggctta
atcgctcagtaccctaaaattgttgcagctgctgcgcaaatgcgccaacctcacagagtc
gctagatatattgaagaggtcgctggccagtttcatcgcttttataatgattgtcgagta
ctgccactaggtgatgaaaaacctgggcctttaaactctgctcgcgccagccttgccatg
gcaactgcgcaggtaatcaataatggtttagatttactaggtgttagcgctccggagaag
atgtaa

DBGET integrated database retrieval system