KEGG   Nitrosococcus halophilus: Nhal_0488Help
Entry
Nhal_0488         CDS       T01198                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00471  D-Glutamine and D-glutamate metabolism
nhl00550  Peptidoglycan biosynthesis
nhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Nhal_0488
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nhal_0488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
    Nhal_0488
Enzymes [BR:nhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Nhal_0488
Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
 Precursor biosynthesis
  Amino acid ligase
   Nhal_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_8 DAO Pyr_redox FAD_binding_3 Thi4 Pyr_redox_2 TrkA_N XdhC_C FAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N NAD_binding_9 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADE13674
UniProt: D5BW24
Position
500066..501424
Genome map
AA seq 452 aa AA seqDB search
MLNEPIPPWTVASAVIVGLGKTGLSCARFLANRGLSVTVVDSREAPPGLAALQEQVPGVA
VRLGDFEVALMQQAERLVISPGVALSEPAIQVAQARGIPVLGDIELFAYWAQAPVIAITG
SNGKSTVTVLVEAMARQAGKKVLSGGNLGLPALELLEKPVPDLYVLELSSFQLETTSTLN
AVAACILNISPDHMDRYPNLEAYVQAKGRVYHGTGAMVINADDVQVAGLAQPERHCLRFT
LGAPAADEYGLRERAGETWLARGHELLLPARQFPLVGRHNLANALAALALGEAAGLPQLA
MLSALREFRGLPHRCEWVAQANGVDWYNDSKGTNVGATVAAIEGLHCQGKLVLIAGGVGK
GADFSPLCAPLSRRARAVVLMGQDAPRLEAALANSVPLYQVNDMGEAVNKASALAEPGDS
VLLSPACASFDMYSGFEARGQAFIQAVQEHLS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgagcccataccaccctggacggtagcaagcgcagtgatcgtcggcctcggt
aaaacggggttatcttgcgctcggttcttagcgaaccgcggcctttctgtgactgtggtg
gacagtcgcgaggcgccgccagggcttgctgcgttgcaggagcaggttccgggagtagcg
gttcggttaggtgattttgaggttgccctgatgcagcaggccgaacggttggtgataagc
ccaggggtagccctcagtgagcccgccattcaagttgcccaagcgagaggaataccggtg
ctgggggatattgaattgtttgcctactgggcgcaggcaccggtgatcgcgattacaggc
tccaatggtaaaagtacggtaaccgtgctcgttgaggcgatggcacgccaggctgggaaa
aaggttctctcaggcggcaatctgggcctccctgccttggaattattggaaaagccggtg
ccagacctctatgtgttggaattgtccagttttcaattggagacaacctctacgctaaat
gccgtcgccgcctgcatactcaatatcagccctgatcatatggatcggtatcctaatctt
gaggcctatgtccaggctaaagggcgggtctatcacggtaccggagccatggtaattaat
gccgatgatgtccaggtagcaggtcttgcccagccggagcgacactgccttcggtttacc
ttgggggcgcctgctgctgatgaatatggtctgcgggagcgggcgggtgaaacctggctg
gcccgggggcatgaattattactgcccgctcggcagttccccttagtgggacgccataat
ttagcgaatgccctggcggcgttggccctgggggaggcagcagggttgccccagcttgcg
atgctatccgctttgcgggagttccggggtttgccccatcgttgtgaatgggttgcccag
gcaaacggagtggattggtacaacgattccaaggggactaacgtgggggccacggtggcc
gcaattgagggacttcactgccaaggtaaattagtgctcattgcggggggggtcggcaag
ggcgcggatttttctcctttatgcgcacctttatctaggcgggcaagggccgtcgtctta
atgggccaagatgctccccggttggaggcagcgcttgcaaatagcgtccccctctatcag
gtgaatgatatgggggaagcggtaaataaagcgagtgccctagccgagccgggtgatagc
gtgctgttgtcccctgcgtgtgccagttttgacatgtattccggttttgaggcccgtggt
caggcctttatacaagccgttcaggagcacttgtcatga

DBGET integrated database retrieval system