KEGG   Nitrosococcus halophilus: Nhal_0681Help
Entry
Nhal_0681         CDS       T01198                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01130  Biosynthesis of antibiotics
nhl01230  Biosynthesis of amino acids
Module
nhl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nhal_0681
Enzymes [BR:nhl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nhal_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADE13861
UniProt: D5BWY0
Position
complement(687450..688268)
Genome map
AA seq 272 aa AA seqDB search
MNEAPDILRKILQRKAEEITERAQQLSIRELSRQVEAAPPVRSFVNAITQKIRAQQFAVI
AEIKKASPSKGLLREVFDPAAIARSYEQGGATCLSVLTDRNFFQGSEANLRLARSACGLP
VLRKDFIIDPYQVYEARVMGADCILLIAAALGDALMLELTQLAEHLDMDTLVEVHSAEEL
ERALALNTPLIGINNRNLKNFETKLETTLDLLPQIPPDRLVVTESGIHSTADVMRMKEAG
VYGFLVGETFMKAEEPGEKLAELFRHSERLSS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggcccccgatatcttgcgaaaaatcttacaacggaaagccgaggagattacc
gaacgggcgcaacaactttcaatccgggagctcagccgacaagtggaggcagcgcctcca
gtacgcagctttgttaatgccatcacccaaaagataagggcccaacagtttgccgttatt
gctgaaatcaaaaaggcctctcccagcaaagggctccttcgggaggtctttgatccggca
gcaattgcccgtagctacgaacaagggggggcgacttgcctgtcagtactcacagatcgc
aatttttttcagggtagcgaagcaaatctccgcctggctcgaagtgcttgtggattaccc
gtgttaagaaaggattttattattgatccctaccaggtctatgaggctcgggtgatgggt
gccgactgtattctactgattgcagcagccctaggcgacgccctgatgctagaactcacg
caactcgctgaacacctggatatggacacccttgtagaagtacacagtgccgaagagctt
gagcgggctttagccctaaatacgccacttatcggtattaataaccgaaatttaaagaac
tttgagacaaagttagagactacccttgacctacttccccagataccacccgatcgccta
gtagttactgaaagcggtattcatagcaccgcggatgtaatgaggatgaaagaagccggg
gtctatggcttccttgttggcgaaacctttatgaaagcagaagagcccggcgaaaagctt
gcagaactattccgacactcagagagattatcctcctaa

DBGET integrated database retrieval system