KEGG   Nitrosococcus halophilus: Nhal_1826
Entry
Nhal_1826         CDS       T01198                                 

Definition
(GenBank) ATPase, P-type (transporting), HAD superfamily, subfamily IC
Organism
nhl  Nitrosococcus halophilus
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase LysM Hydrolase_3 HAD
Other DBs
NCBI-ProteinID: ADE14947
UniProt: D5C355
Position
1874488..1877751
AA seq 1087 aa
MKSVKQESGHAHTVEAVLQRIGSDRLGLTQSEAEQRLQQYGPNRLTPPKRRGPIERFLVQ
FHNVLIYVLLAAAVVTALLAHWVDTGVILGVVVLNALIGFIQEGKAEQALEALRHLLSPQ
ASVLRDGRHRMIPAEQLVPGDVVTLQSGDKVPADLRLIRVKNLRIEEAALTGESMPVEKA
LEPVAENASLGDRTNMAYSGTLVTYGTAEGVVVATGDHTEIGRISAMLGQVQTLTTPLLR
QMAVFGRWLTAVILGVAAAVFAFGVGVRGYSFHEMFLAAVGLAVAAIPEGLPAIMTITLA
MGVQRMARRNAIIRRLPAVETLGSVNVICSDKTGTLTRNEMTVRTVITADAGFEISGVGY
NPHGGFSQQGQIILMDDYPGLGELCRAGLLCNDAILHNVEATWVIQGDPTEAALVSLAMK
ANLLPEWEREEWQRVDVIPFESEHRFMATLHHDRVGHAFIYLKGAPEQVLEMCHHQRSRG
EDEPLDLPYWHDRILEMASRGERVLAVAFRVTHTDHCNLRFEDVQEGLTLLGLFGIIDPP
REEAIAAVKECQEAGIRVKMITGDHLLTAQAISRQLGLKHSDQALAGTKLEVMDDETLRN
VILDVDVFARASPEHKLRLVKALQSQGRVVAMTGDGVNDAPALKRADVGIAMGQKGTEVA
KEAAEAVLADDNFASIAQAVKEGRTVYDNLKKAILFILPTNGGEAMALVAAILLGYMLPI
TPVQILWINMVTAVTLALALAFEPPEGNVMRRPPREPGEPVLSGFLVWRIVFVSVILVVG
TFGLFLWYREQGAPIEYARTIAVNTLVMFEIFYLLNTRYMTNSVLSREGLLGNRYVLIAI
AVVVGLQLLFTYTGPMQQLFASVALGLHDWGWIVLVTSSVFVLVELEKSFLRRRKEKAPP
RRVEPPVAAFERFKPRRVWPAALILLLLGVGVGSWIWVQFEGEEKEAIVVAEAERQARPP
AEPLPDTQTPGVKTPSDRETTPAPQQPEVAAIPLPEKEKEVPERPEMVPKPPIKEVEEEP
EQIEVSPAAKTVTVQPGDTLSQIAARAYGDPTQWPLIYEANRGKIENPNVIIPGMELTLP
PAPKNQD
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgaagtcggtaaagcaagaaagtgggcatgcccatacagtagaggccgtattacagcgg
ataggcagtgaccgtctgggattgacccagagcgaggcagagcaacgccttcagcagtat
ggtcccaaccggctcaccccgcctaagagaaggggacccatagaacgctttctggtccaa
tttcataatgtgctcatttatgtgctgcttgccgccgctgttgtcaccgctttgctcgcc
cattgggtagatacgggggtcattctcggggtcgtggtgctcaatgccctgattggtttt
attcaggaaggaaaagctgagcaggcgctagaggccctccgccacctcctttcgccccaa
gccagcgtattacgggatggtcggcataggatgatacctgctgagcagttggtccctggc
gatgtggttaccctacagtcaggggataaggtgcccgcagatcttcgccttatccgggtg
aagaacttacgcattgaggaagccgccctgaccggagaatccatgccggtggaaaaggcc
cttgaacccgttgccgaaaatgcgtctttgggggatcggactaacatggcttattctggc
accttggttacctacgggacggcggaaggggtagtcgttgccacgggggatcataccgag
atcggacgtattagcgccatgctagggcaggtacaaaccttgaccacgcctttgctgcgg
cagatggctgtgtttggccgctggttaacggcggttatcttaggggtggcggcggcggtt
tttgcctttggggtaggggtccgaggttattcttttcatgagatgtttcttgccgctgta
gggcttgcggtggcagccattccggaaggattgcccgccattatgaccattaccttggca
atgggggtccagcgcatggcccggcgtaatgccattattcgtcgtcttcccgcagtggag
actttaggttctgtcaatgtgatctgttctgacaaaacgggcaccttgacccggaatgag
atgacggtgcgcacggtgatcaccgcagacgctgggtttgagatcagtggggtagggtat
aacccccatggcgggtttagccagcaaggccagattatcctgatggatgattatcctgga
ttaggagagctttgccgtgctggcctactttgcaatgatgcgatcctccacaatgtggaa
gctacctgggtcattcaaggggatcccactgaagcggctttagtgagcctggcgatgaag
gcgaatttgttaccggaatgggaacgggaggaatggcagcgtgttgatgtgattcccttt
gaatcagaacaccgcttcatggcgactctgcatcatgatcgggtgggccatgctttcatc
tatctcaaaggggctcctgagcaggttttggaaatgtgtcaccatcagcgtagccggggt
gaagatgagccgttggatctaccctattggcatgatcgtattctagagatggcaagccgg
ggtgagcgggtattagcggtggcttttcgggtgacccacactgaccactgtaatttgcgc
tttgaggatgtacaagaggggctgaccctgttgggactatttggaattatcgatcccccc
cgggaggaagccattgctgcggtcaaggagtgtcaggaagcgggaatccgggtcaagatg
attaccggagatcatctcttgactgcccaggccatcagtcggcaactgggccttaaacat
agtgatcaggctctagctggtacaaagttggaggtcatggatgatgagaccctccgtaat
gtgattttggatgtggatgttttcgcgcgggctagccctgaacataagctccgtctagtc
aaggccttgcagtctcaaggacgggttgtggccatgaccggcgatggcgttaacgatgca
cctgcgttgaagcgggctgatgtgggcattgccatgggtcaaaagggtacggaggtggcg
aaggaggctgccgaagccgtgctcgccgatgataattttgcctccattgcccaagcggtg
aaggaagggcgtaccgtctatgacaatctgaagaaagccatcctttttattttacctacc
aatgggggcgaagccatggccttggtcgccgccattctattgggctatatgctccccatt
actccggtgcagatcctatggattaatatggtcaccgcagtcacccttgctctggccctt
gcttttgagcccccagagggcaatgtcatgcgtcgtcccccccgggagccaggggagccg
gtgttatccgggtttttagtttggcggattgtctttgtttcggtcattttggtggtaggc
actttcgggctcttcctgtggtatcgcgagcagggtgcccctattgaatatgcccgtacc
atagccgtgaataccttggtgatgttcgagatcttctatcttctcaacacccgctatatg
actaactccgtcttatcccgagagggcctgttgggtaaccgttacgtcttgatagctatt
gccgtagtagtagggcttcagttgctatttacctataccggaccgatgcagcaactattt
gccagcgtggctctaggcctccatgattggggctggattgtgctggtcacctcttccgta
tttgtgctcgtggaactagagaaatcctttttaaggagaaggaaagaaaaggccccgccc
cggagagttgaaccgcctgtggcggcatttgagaggtttaagccccggagagtctggcca
gcggcgctcattcttctactgcttggcgtgggggtaggcagttggatatgggttcagttc
gagggagaggaaaaagaagcgatagtggtggcggaagcagaaagacaggcgcggccacct
gccgagcccctgccggacacgcagactccgggggtaaaaacgccttctgacagggagacg
acgcctgccccccagcagcctgaagtggcggcaataccgctgccggagaaagagaaggaa
gtaccggaaaggcctgaaatggtccctaagccccccataaaggaagtggaagaagaaccg
gagcagattgaagtgtctccagcggcaaagacagtgactgtccagccgggcgataccctc
tcccagatcgctgcacgtgcctacggcgatcccactcaatggccgcttatctatgaagcc
aatcggggcaagattgagaaccctaacgtcatcatcccaggcatggagctgactcttccc
cctgcacctaaaaatcaggactaa

DBGET integrated database retrieval system