KEGG   Nitrosococcus halophilus: Nhal_2480Help
Entry
Nhal_2480         CDS       T01198                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00071  Fatty acid degradation
nhl00072  Synthesis and degradation of ketone bodies
nhl00280  Valine, leucine and isoleucine degradation
nhl00310  Lysine degradation
nhl00362  Benzoate degradation
nhl00380  Tryptophan metabolism
nhl00620  Pyruvate metabolism
nhl00630  Glyoxylate and dicarboxylate metabolism
nhl00640  Propanoate metabolism
nhl00650  Butanoate metabolism
nhl00900  Terpenoid backbone biosynthesis
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01200  Carbon metabolism
nhl01212  Fatty acid metabolism
nhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nhal_2480
   00630 Glyoxylate and dicarboxylate metabolism
    Nhal_2480
   00640 Propanoate metabolism
    Nhal_2480
   00650 Butanoate metabolism
    Nhal_2480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nhal_2480
   00072 Synthesis and degradation of ketone bodies
    Nhal_2480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nhal_2480
   00310 Lysine degradation
    Nhal_2480
   00380 Tryptophan metabolism
    Nhal_2480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nhal_2480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nhal_2480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Nhal_2480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhl04147]
    Nhal_2480
Enzymes [BR:nhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nhal_2480
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nhal_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADE15565
UniProt: D5BVY6
Position
complement(2548093..2549397)
Genome map
AA seq 434 aa AA seqDB search
MEQGGQRSLPRPVYIIDGNRTPFLKARGKPGPFTAADLAVAAGRPLLARQPFEPEVLSEV
VLGCVMPGPDEANIARVTALRLGINERVPAWTVQRNCASGMQALDCAALDIANGRADLVL
AGGVEAMSHAPVLLSRPLVDWLGDWNRARNLSTRLRLLGRLRPYHLRPIIGLLRGLTDPV
VGLSMGQTAEVLAHRFAIDRQTMDAYALESHQRLAHAQESGWLSEVSPLFASNGQIFEHD
DGLRRDTSMAQLSKLKPVFDRPYGLVTAGNSAQVTDGACWLLLASEQAVHQYQLPVMGRI
IDSQWAALDPAQMGLGPVHATTPLLQRHQLNLNDLDVWELNEAFAAQVLACLRAWQDPDY
CRSELGLAEALGELDRKRLNVDGGAVALGHPVGASGARIVLHLLHALERVNGQRGIATIC
IGGGQGGAMLLERG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaggtggacaacgctccctgccccgacctgtttatattatcgatggcaatcgg
actccattccttaaggcccggggcaaacctggtcccttcacggcggcggacctagcagtc
gccgccggccgtccactactggcccgccagcccttcgaacccgaggtactaagcgaggtc
gttctgggctgcgtcatgcccggcccggatgaggccaatatcgctcgggtcaccgccttg
cgcttagggattaatgaacgggtccccgcttggaccgtacaacgcaattgtgcctccggc
atgcaagcccttgattgtgcggctcttgatattgccaacggccgtgcggacctggtattg
gctggcggcgtggaagccatgagtcacgcaccagtgctgctaagccggcccctggtggat
tggttaggagactggaaccgagcccgcaaccttagcactcggctacgcttactagggcgt
ttacgtccctaccatctacgccctattatcggtctattgcgggggttgaccgaccccgtg
gtggggctatccatgggacaaacggcggaggttctcgcccaccgcttcgccatcgaccgc
caaactatggatgcttacgcccttgagagccaccagcgcttggcccacgctcaagagagc
ggctggttaagcgaggtaagtcccctattcgcctccaatggtcaaatctttgaacacgat
gatgggctacgccgcgacacctcgatggcccaacttagcaagctcaaacccgtttttgac
cgcccctatggcctagtcaccgcaggcaatagcgcccaggtcactgatggggcttgctgg
ctactactggcttcagagcaggctgttcatcaatatcaacttccggtcatggggcgcatt
atagacagccagtgggcagcgctagatccagcccagatgggactggggcctgtacacgcc
acaaccccattgctgcaacgccatcaactcaaccttaatgacctggatgtttgggaattg
aacgaagcctttgccgcccaagtcctggcctgtttgagggcttggcaggatccagactac
tgccgcagtgaactcggcttggcagaagcccttggcgaattggatcgaaaacggctcaat
gtggatgggggtgccgtcgccttgggtcacccggtcggtgccagtggtgctcgtattgtg
ctgcacttgctacacgccttggagcgcgtcaatggccagcgcggtatcgccaccatttgc
attggtggaggtcagggcggtgctatgctattagaaaggggataa

DBGET integrated database retrieval system