KEGG   Nitrosococcus halophilus: Nhal_2977Help
Entry
Nhal_2977         CDS       T01198                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nhal_2977
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Nhal_2977
DNA repair and recombination proteins [BR:nhl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Nhal_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 HHH_2 AAA_11 Helicase_RecD PIF1 DUF2075 AAA_22 NTPase_1 TrwB_AAD_bind AAA_16 RsgA_GTPase T2SSE AAA_28 cobW AAA_29 ABC_tran AAA_5 AAA_14 AAA SRP54 AAA_23 AAA_24 ATPase_2
Motif
Other DBs
NCBI-ProteinID: ADE16037
UniProt: D5BYP9
Position
complement(3055869..3058061)
Genome map
AA seq 730 aa AA seqDB search
MKPPLHSETPPEFLTGAVERVTFHSEENGFCVLRIKVRGERDLITVVGNTPTVTPGEYVE
CHGEWVNDRTHGLQFKTKHLRVIPPSTLEGIEKYLGSGMVKGIGPHFAKKLVQAFGEQVF
EVIEHESERLTELDGIGPKRKEQVIQAWAEQRVIRAIMVFLQSHGVGSARAVRIYKTYGD
KAIERVRENPYRLALDIHGIGFKTADRIAQRLGIPADSLIRAQAGVRHVLQEFANEGHCA
MEQGRLVETASQLLEIPAPIIEQAITQEVAEGQLIAEIIAGKPCLFLAPLYRSEIGVAKH
LQRLLRGVPPWGQINADKAIPWVEAKTGLLLSPSQRVALIQTINNKITVITGGPGVGKTT
VVNSILRIVRAKQTQVLLGAPTGRAAKRLAESTGLEAKTIHRLLEFDPHAMGFKHHAANP
LQADLIVIDEVSMVDVGLMNQLLQAIPNHAACILIGDKDQLPSVGPGQILADIIASQKIS
TVHLSEVFRQAASSKIVVNAHRINQGKMPEKADEAATLSDFYFIPTKSPETIQDRVLELV
TSRIPKRFGFDSTRDIQVLTPMNRGSLGARALNGLLQQQLNGQSQPKINRFGWSFAPGDK
VIQTVNNYDKEVFNGDIGRITRIALEEGLVHIDFDGREIEYELGELDEIALAYATSVHKS
QGSEYPAVVIPLAIQHYTLLQRNLLYTGITRGKRLVVLVGQPKALAIAVKRINSTARLTH
LSARLANSQI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccctccactcagaaactccacccgaatttctcactggtgctgtagaacgc
gtcactttccatagtgaggaaaatggattttgtgtcctacgaattaaagtgcgtggtgag
cgggatctcatcaccgtggtcggcaataccccaacggtcacgccgggtgagtatgttgaa
tgccacggtgagtgggtcaacgaccgcacccatggtctccaatttaagaccaagcattta
agagttatccctcctagcaccctagaaggaatcgaaaaatatctaggctcaggaatggtc
aaaggaatcggtccccactttgccaagaaattggtacaagcctttggcgaacaggttttc
gaagtcatcgagcacgagtctgagcgcctcaccgaattagacggtatcggccccaaacgc
aaagaacaagtcattcaggcctgggcagaacagagggtcattcgagccatcatggtgttt
ctacaatcccatggagtgggtagcgccagggcagtccgtatttataaaacctatggcgac
aaagccatcgagcgggttcgcgaaaacccctaccgacttgcactcgatatccatggcatt
ggctttaaaactgccgataggattgcccaacggctgggaatccctgccgattctctcatc
cgcgcccaggcgggggttcgtcatgtgctccaggaatttgctaatgaaggacactgtgcc
atggaacagggacgattagtggaaacggctagccaattgctggaaatccccgcccctatc
attgaacaagccattactcaagaagtcgctgaaggacaactaatagccgagatcattgcg
ggcaaaccctgcctatttctagctccactttatcgatcagaaataggcgtggccaaacat
ttgcagcggcttctccgaggggtacccccctggggacaaattaatgccgataaagcgatc
ccctgggttgaagccaaaacaggattgttactctccccctctcaacgggttgcccttatt
caaacaatcaacaacaagatcaccgtcatcaccgggggacctggtgtcggcaaaaccacc
gtcgtcaacagcattctccgaattgttcgggccaagcaaacccaggtactcctgggggcc
ccgaccgggcgggcggcaaaacggctagccgaatccactggcctggaagccaaaacgatc
catcgtctgcttgaattcgatccccatgcaatgggtttcaagcaccatgcggccaacccc
cttcaagccgatctcatcgtcattgatgaggtttccatggtagacgtggggttgatgaat
caattgctccaagctattcctaatcatgcagcatgcatactgataggcgataaagaccag
ttaccttcggtgggacccgggcagatactcgcggatattatcgcctcccaaaaaatctcc
accgttcacctcagcgaagtctttcgccaggcagccagttccaagatcgtcgtcaatgcg
caccgaatcaatcaaggaaaaatgccagagaaagccgatgaagcggccacacttagcgac
ttctacttcattcccaccaaatctccagaaactatccaggatagggtgctggaattggta
accagccgtattcccaagcgtttcggatttgattctactcgcgacattcaagtccttacc
cccatgaatcggggcagtctcggtgcgcgagcactgaatgggctcttgcaacaacaactc
aatggacaatctcaacccaagatcaatcgctttggttggagctttgcccccggcgataag
gtcattcaaactgtcaataattatgacaaagaagtgtttaatggggatattggaaggata
accaggatagcccttgaggaaggactcgtacatatcgacttcgatggccgagagatagaa
tacgaattaggcgaacttgacgaaattgctttggcctatgccacctcggtgcacaagagc
caaggctcggaatatcccgcggtcgtcattcccctcgccattcaacattacaccctgtta
caaagaaacctgctttacaccggcattacccggggcaaacggctagtggtacttgtggga
caacctaaggccctcgccattgccgtcaaaaggatcaattcaaccgctcggctgacccat
ctttcagcccgattagctaacagtcaaatttaa

DBGET integrated database retrieval system