KEGG   Nitrosococcus halophilus: Nhal_3222Help
Entry
Nhal_3222         CDS       T01198                                 

Definition
(GenBank) Asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00250  Alanine, aspartate and glutamate metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nhal_3222
Enzymes [BR:nhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nhal_3222
Peptidases [BR:nhl01002]
 Cysteine Peptidases
  Family C44
   Nhal_3222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ADE16272
UniProt: D5C025
Position
complement(3305428..3307248)
Genome map
AA seq 606 aa AA seqDB search
MMGLCGLSNFPKELSDEKLLREMSKGFRHSGKLCTALIERAACAASEQRLALLPEGLVVA
ITGQPWWSDSELERIAREQGEGDALGEAYRRHGTGLLQYLHGAFAMAVLEGRSGRVFAAV
DRVGQEPLYYAAAGGGFVLGSSADCVRAHPGIDCSLSSQAIYNYVYAHMVPSPGTIYSSL
HKLPGGHYVEYDGNQIHMGSYWEPPFDETNSANLDVLGEQMRTLILESVERLSKGRIAGA
FLSGGLDSSTLAGMLARLQPGNANTYSIGFTATGYDEMGYARTVSRHFGTKQHEYYVTPE
DVCAIVPEIARVYDEPFGNSSAVGVYYCAKLAANDGVERLLAGDGGDEIFAGNARYAKQQ
VFEYYGVMPLLLRRGLLEPLLFRLPETVGVVRKAQSYVRQAMTPLPDRLEAYNFLQREGA
QEMFQADFLAALAPEEPLLLQRERYTRPQNASALNRMMYLDWQQTLADNDLRKVGRMCAL
AGVDVVYPLLDDPLLEFSCRVPSALKLKGRRLRHFYKEAMRDFLPQETIMKHKHGFGLPF
GVWMAEHAPLRELAYESLLCLKKRPYFRPGFLERAIDLHRTGHAAYYGELVWILMMLELW
LQAHGH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcctttgtgggttatccaatttccctaaagagctaagtgatgagaagttgctc
cgcgagatgagcaagggctttcggcattcggggaaattatgcacagccttgattgagcgg
gctgcctgtgcggcgtccgaacaaaggttagccctgcttcccgaagggctagtggttgca
atcacggggcagccttggtggtcggattccgagcttgaacgcattgcccgggagcaagga
gaaggtgatgcgcttggtgaagcctatcggcgccacggtacggggcttttgcaatacctt
catggtgcctttgccatggccgtactggagggccgttcgggccgagtatttgcggcggtg
gaccgcgtcgggcaggaacccctctactatgcggcggctggtggtggatttgttttgggc
tcaagcgccgattgcgtacgggctcatccgggcattgattgctcgctctcgtcccaggcc
atttacaattatgtctacgcccatatggttccgagtcccggcactatttactcaagtctg
cacaagctgccggggggccattatgtagaatatgacggcaatcaaatccacatgggaagc
tattgggaacccccttttgatgaaaccaatagtgccaatctcgatgtattaggcgaacag
atgcgcacccttattctggaatcggttgaacgccttagcaaggggcggatagccggcgcc
tttttgagtggtggcctggatagctcgaccctggcaggcatgcttgccagattgcagccg
ggcaacgccaatacctactccattggctttacggcgaccgggtatgacgagatgggttat
gctcgcaccgtatcccgacatttcggcaccaagcaacatgaatactatgtcacacctgaa
gatgtctgtgccatagtgcccgagattgcccgggtttatgacgagccttttggcaattcc
tcggcggtgggcgtttactactgtgccaagcttgccgctaatgatggtgtggagcgtctg
cttgcaggggatgggggcgatgaaatctttgcgggcaacgcccgctacgccaaacagcag
gttttcgagtattacggtgtaatgcccctccttctgcggaggggattattggagcctctt
ttgttccgtctgccagagaccgtcggtgtcgtccggaaagcgcaaagctatgtgcgccag
gcgatgacgccactgccggatcgcttggaggcttacaacttccttcagcgggaaggtgcc
caagaaatgtttcaggcagattttttagccgccttagcgccggaagagcccttgctcctg
caacgggagcgatatacgaggccccaaaatgcttcggcgctcaatcggatgatgtatctt
gattggcagcagacccttgcggacaatgatctgcgcaaggttggacgaatgtgtgcgctt
gcaggggtggatgttgtgtatccgctgctcgatgatccacttcttgaattttcctgccgg
gtaccgtcggcgctcaaactcaaggggcggcgtcttcgccacttctataaggaagccatg
cgcgatttccttccccaggagaccatcatgaaacataagcatggttttggattaccattt
ggcgtgtggatggcggaacacgccccgctccgggagcttgcctatgaaagtctgctctgc
ctcaaaaagcgaccctatttccgccccgggtttcttgagcgggctatcgatcttcaccga
accgggcatgctgcctattatggggaattagtatggatactgatgatgctggagctttgg
ctccaagcccatggacattga

DBGET integrated database retrieval system