KEGG   Nitrosococcus halophilus: Nhal_3435Help
Entry
Nhal_3435         CDS       T01198                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00630  Glyoxylate and dicarboxylate metabolism
nhl00710  Carbon fixation in photosynthetic organisms
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01200  Carbon metabolism
Module
nhl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nhal_3435
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nhal_3435
Enzymes [BR:nhl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nhal_3435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADE16464
UniProt: D5C1B2
Position
3541963..3543384
Genome map
AA seq 473 aa AA seqDB search
MAKKTYTAGVKEYRETYWMPEYTPADTDILACFKVTPQPGVPREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYAIEDVPGDDESFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KALRALRLEDVRFPIAYVKTCGGPPNGIQVERDKMDKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRQRFEFVMEAIHKAEAETGERKGHYLNVTAPTP
EEMYKRAEFAKELKAPIIMHDYITGGFCANTGLANWCRDNGMLLHIHRAMHAVLDRHPKH
GIHFRVLAKILRLSGGDHLHSGTVVGKLEGDRAATLGWIDIMRDKFIKEDRSRGIFFDQD
WGSMPGVFPVASGGIHVWHMPALTAIFGDDSVLQFGGGTLGHPWGNAAGAAANRVSLEAC
VEARNQGRPIEKEGKEILTTAAKNSPELKVAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaaacttataccgcgggcgttaaagagtaccgcgaaacttactggatgcca
gaatataccccagccgatactgacatcctggcctgttttaaggtgactccacagcctggg
gtaccccgtgaagaagctgccgcagcggttgccgcagaaagttccaccggaacatggacc
acagtatggaccgatctgctcaccgatctcgattactataaaggacgtgcctacgctatc
gaggacgttcccggcgatgatgaatccttttatgcctttatcgcctatcctatcgatctg
tttgaagaaggttcggtagtcaatgtatttacttccctggtcggtaatgtctttggcttt
aaggcccttcgcgccctgcgtctggaagacgtccgttttcccatcgcctatgtaaagacc
tgcggcggtccacccaatggtatccaagtcgagcgggacaaaatggacaaatatggccgt
cccctactgggttgtaccatcaagccgaagctgggcctctccgccaagaactatggccgt
gccgtatacgagtgcctgcgcggcggcttggacttcaccaaggacgacgaaaatgtcaac
tcccaacccttcatgcgctggcggcaacggtttgagtttgtcatggaggctattcacaag
gcggaggccgaaaccggcgagcgcaaaggccattatttgaacgtcaccgcacctaccccg
gaagaaatgtacaagcgggccgaattcgccaaggaattaaaagcccccatcatcatgcac
gactatatcaccggcggcttctgcgccaacacgggcctggccaactggtgccgagataac
gggatgctgctgcacatccaccgcgccatgcacgccgtactcgatcgccaccccaagcat
ggcatccacttccgggtgttggccaaaattctgcgcctgtccggcggcgaccacctgcac
tccggcaccgtcgtgggcaaactcgaaggtgaccgggcggcaaccctaggctggattgat
atcatgcgggataaattcatcaaggaagaccgcagccgcggtatcttcttcgaccaggat
tggggctccatgcctggcgtcttcccggtcgcttccggcggtatccatgtctggcacatg
cccgcgttgaccgccatcttcggcgatgactcggtacttcagtttggtggcggcacttta
ggtcacccctggggcaacgcagcgggtgctgcggctaaccgcgtctctctggaagcctgc
gtcgaggcccgcaaccaaggccgcccgatagagaaggaaggcaaggaaatcctaacgaca
gcggccaaaaacagccccgagctcaaagtcgccatggaaacttggaaggaaattaaattc
gagtttgacaccgttgacaaactagacgtggcccacaaataa

DBGET integrated database retrieval system