KEGG   Nitrosococcus halophilus: Nhal_3492Help
Entry
Nhal_3492         CDS       T01198                                 

Definition
(GenBank) Retinal dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00010  Glycolysis / Gluconeogenesis
nhl00053  Ascorbate and aldarate metabolism
nhl00071  Fatty acid degradation
nhl00280  Valine, leucine and isoleucine degradation
nhl00310  Lysine degradation
nhl00330  Arginine and proline metabolism
nhl00340  Histidine metabolism
nhl00380  Tryptophan metabolism
nhl00410  beta-Alanine metabolism
nhl00561  Glycerolipid metabolism
nhl00620  Pyruvate metabolism
nhl00625  Chloroalkane and chloroalkene degradation
nhl00903  Limonene and pinene degradation
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_3492
   00053 Ascorbate and aldarate metabolism
    Nhal_3492
   00620 Pyruvate metabolism
    Nhal_3492
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nhal_3492
   00561 Glycerolipid metabolism
    Nhal_3492
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nhal_3492
   00310 Lysine degradation
    Nhal_3492
   00330 Arginine and proline metabolism
    Nhal_3492
   00340 Histidine metabolism
    Nhal_3492
   00380 Tryptophan metabolism
    Nhal_3492
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nhal_3492
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nhal_3492
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nhal_3492
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Nhal_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADE16516
UniProt: D5C1G4
Position
3596298..3597782
Genome map
AA seq 494 aa AA seqDB search
MSPSASLPLTHKEQVEVRQTRLLIDGEFRDSLSGKTFATIDPVTEEVIAQVAEGDAEDID
LAVKAARKAFDTGPWQQMDARERGRRMLKWADLIETHMEELAKLEVLDNGKPINEALGYD
IPSAAATIRYFAGWADKIHGKTIPVSGPFFTYTRREPVGVCGLIIPWNFPLAMAAWKLGP
ALAAGCTTILKPAEQTPLTALRAGELALEAGIPPGVLNIVPGFGPTAGAALVQHPLVEKI
AFTGEYKTAQIIKQATVNSMKRLSFELGGKSPNIIFNDANLEDAITGSFGAIFLNQGQNC
CAGSRAFVQDNIYNEFVERFADKAEKRRLGDPFDSNTEHGAQIDKAQFDKIMHYIALGKE
QGAACVTGGNQAFDRGYFIQPTVFSEVNENMAIATDEIFGPVVSVLRFKDINEVIAKANN
TMFGLAAAVWTQDIDKANAVAEGVKAGTVWVNCYNIVDPAAPFGGFKMSGVGRELSEQAL
DAYTETKTVTVLRK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgtcagcctcattgcccctaactcacaaagaacaggtagaagtgcgccagact
cgcttgctgattgacggtgagttccgcgacagcctcagcggtaagacctttgccaccatc
gacccggttaccgaagaagtgatcgcccaggtggctgaaggggatgcggaagatattgac
ctagcggttaaagccgctcgcaaagccttcgataccggcccttggcagcaaatggacgct
cgcgaacggggccgccggatgttgaagtgggctgatctaatcgaaacccatatggaggaa
ctggctaagcttgaagtcttggacaatggtaaacccattaatgaggccttaggctatgat
attcccagtgccgcggccaccatccgttattttgccggctgggcggacaagatccatggc
aagaccatccccgtttccggtcctttctttacttatactcgccgggagcccgtcggggtt
tgtggcctcatcattccctggaattttcccttggcgatggcggcctggaaattaggccct
gccctagccgccggctgcacaaccattctaaaaccggcagagcaaactccgctaacggcc
cttcgtgccggggaactggccctggaggcaggaatccccccaggggtactcaatatcgtg
cccggcttcggtcccacggcaggtgctgcattggtacaacaccccctggttgaaaaaatt
gccttcacgggagaatataaaaccgcccaaatcatcaaacaggccacggtcaatagcatg
aaacgcttgtcctttgagcttggcgggaagagccccaatatcatttttaatgatgccaac
ctggaagacgccatcaccggttcctttggtgccatttttctaaatcagggacagaattgt
tgcgccggcagccgcgcctttgtgcaggacaacatttataatgaattcgtggaacggttt
gccgataaggcggaaaagcgcaggctgggagatcccttcgattccaataccgaacatgga
gcccaaatcgacaaggcccagttcgacaaaatcatgcactatatcgccctgggcaaagaa
cagggcgcggcatgcgtcaccggcggcaaccaggctttcgaccggggttattttatccaa
cccaccgtctttagtgaggtcaatgagaatatggccattgccaccgacgaaattttcggg
ccggtggtcagtgtcttgcgtttcaaagacatcaatgaagtgattgcaaaagccaacaac
accatgtttggccttgccgctgccgtatggacccaagatattgacaaagccaatgcggtg
gccgaaggcgtgaaagcggggaccgtctgggtcaactgttataatattgtcgatccagcc
gccccttttggaggcttcaaaatgtccggggtcggccgggaactgagtgaacaggccctg
gatgcctatacggaaaccaagaccgtcacggtactacggaagtaa

DBGET integrated database retrieval system