KEGG   Nitrosococcus halophilus: Nhal_3493Help
Entry
Nhal_3493         CDS       T01198                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00260  Glycine, serine and threonine metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_3493
Enzymes [BR:nhl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Nhal_3493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADE16517
UniProt: D5C1G5
Position
3597791..3598831
Genome map
AA seq 346 aa AA seqDB search
MTKCHFVSDNAAGVHPEVMAMMAKASRGHAIAYGNDPFTKQALQLFKQHFGTQTETFFVL
TGTAANVIALQSVMASFEAVICADCAHLHRDECGAPEKFLGSKVLVAKTHQGKLSVETVA
PLLRGMDIVHRAQPKVLSITQCTEWGTIYTSEEIQTLADFCHEHGLLLHMDGARLSNAAA
RLNLSLKEITGDVGVDLLSFGGTKNGLLAAEAIVFFDPELAKNAPFYRKQGMHLVSKMRF
VSAQFLALLSDDLWRRNAQHANGMAALLAERLGNIAQVEIIAPVETNGVFARIPSPWVPR
LQQHYAFAVWDPASTVVRWMTSFDTTAEEVRNFERKIQDVSEENPR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtgtcattttgttagtgacaatgcagcgggtgtccacccagaagtcatggct
atgatggcaaaagccagtcgcggccatgccattgcctacggcaacgatcccttcacaaag
caggccctgcaactattcaagcagcactttggaacccagacggagacgttttttgtgctg
accgggaccgccgccaatgtcattgcgttgcaaagtgtcatggcttctttcgaggccgtt
atttgtgctgactgtgcccaccttcatcgggatgaatgcggtgcgccggaaaaattcctg
ggatcaaaagtgctggtcgccaaaacccatcagggtaagctcagtgtggaaacggttgcc
cccctgttgcgcggcatggatattgtgcaccgcgctcaaccaaaagtgctctccattacc
cagtgcacagaatgggggaccatttatacctccgaagaaatacaaaccttggcagacttt
tgccatgagcatgggttactgctccatatggatggcgcacggttgagcaacgcggctgcc
cggctgaatttaagcctaaaagaaattaccggggacgtgggagtcgatctgctctccttt
ggcggaaccaaaaatggtctgctcgcggctgaggccattgttttttttgatcccgagttg
gcaaaaaatgcccctttctaccgcaagcaaggcatgcatctagtctccaaaatgcgtttt
gtctcggctcagtttttagcccttttatccgatgatctttggaggagaaacgcccaacat
gctaacgggatggcggcgttactagcagaaaggctcgggaatatcgctcaggtggagatc
atcgctcccgtagaaaccaatggagtatttgcccgtatcccgtccccttgggtcccccgc
ttgcaacaacattatgcttttgcagtttgggaccctgctagcacggtggtccgatggatg
acctcatttgatacgacggctgaggaggtacggaattttgaacgaaaaatccaagatgtg
agtgaggaaaacccgcgataa

DBGET integrated database retrieval system