KEGG   Niabella ginsenosidivorans: A8C56_08460Help
Entry
A8C56_08460       CDS       T04418                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00562  Inositol phosphate metabolism
nia00564  Glycerophospholipid metabolism
nia01100  Metabolic pathways
nia01110  Biosynthesis of secondary metabolites
nia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    A8C56_08460
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A8C56_08460
   00565 Ether lipid metabolism
    A8C56_08460
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A8C56_08460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:nia02042]
    A8C56_08460
Enzymes [BR:nia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     A8C56_08460
Bacterial toxins [BR:nia02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   A8C56_08460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 ERM DivIVA
Motif
Other DBs
NCBI-ProteinID: ANH81005
UniProt: A0A1A9I0Z6
Position
2022566..2025085
Genome map
AA seq 839 aa AA seqDB search
MDTRREFLRKSMILSGAAGFRAAVPDSILKALAIDPAPGSTFLDAEHIVILMQENRSFDH
CFGSLQGVRGLNDPRVITLPDQKPVWFQTNDKNETYGPFRLNIKESKVTWMGSLPHSRPS
QVDAFNSGKYDKWLQSKKSGNAKYAQMPLTMGFYTREDLPFNYGMADAFTICDQNFCSAM
TSTTPNRSFFWTGNIRDHDDGYPRDNIRNDNFAHAKMTWKTFPELLSENNISWKFYQNEI
SCGGGFKGEERSWLANFGCNLLEFFKAYNVKFTPYYIENLKKQVERLPGEINKLQEESPS
SDEAAQRIKNALIKKQQALDNATAELKQWSAENFNKLTDEQKQLFYNAFVNNKGDKNYRS
LSQLKYTDGGKERVVTVPAGDVFYQFRKDVDAGKLPTVSWFAGPQNFSDHPSAPWYGAWY
VSEILDILTKNPEVWKKTIFIVTYDENDGYYDHVPPFSICDNNKPGTGKCSAGIDTEIEH
VRLEYELKQGIAKKQAREAPVGLGFRVPMIIASPWSRGGKVCSQLFDHTSTLQFLETFVN
QKYKKNIHFDNISAWRRTICGDLTAAFSPFDGKPVERVPFLKRDAFVETIFNAQFKQEPG
NFNQLSAGDLQKVIENPAALAFMPQQEKGTRPSLSLPYELYADGKLSKDKKHFEVVLKAG
NQFFGKKAQGSPFTAYAPVNYKEGDAAEVCRNWSFAVKAGDALQYEWPVRSFDNNSYHLR
IHGPNGFYREFKGTADDPDFELGCAYETDNKGKPTGNLLLKLNSSAPVSIEIADNAYKNA
TLRKQVSGAQNVVLNLDKSGGWYDFSVKITGSNAFEKRYAGRVEKGTDSITDPFMGRVV
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggataccagaagggaattccttagaaaatcaatgatcctgtccggtgccgcgggtttt
cgcgcggcggtgccggattctattttaaaagcgcttgctattgaccctgcaccgggaagc
acgttcctggacgcagagcatattgtgattctgatgcaggagaaccgctcctttgaccac
tgttttggaagcctgcagggcgtacgcggcttaaatgatccaagggttattaccctgccg
gatcagaagcccgtatggttccagaccaatgataagaacgagacctatggcccctttcgt
ttgaatataaaagaatccaaggttacctggatgggctcactgccgcattcccgccccagc
caggtagacgcatttaatagcgggaaatatgataaatggctgcaatcaaaaaaatccggc
aacgctaagtatgcgcaaatgccgctgaccatgggcttttatacaagggaagacctgccg
ttcaattacgggatggcagatgcctttacgatttgtgaccagaatttctgctcggccatg
accagcactacccctaaccgttcttttttctggacggggaacatccgcgatcatgacgat
ggctacccgcgtgataacatccgcaatgataattttgcccatgcaaaaatgacctggaaa
acttttcctgaactgctttcagaaaataatatttcctggaaattctatcagaatgaaata
tcctgtggcggtggcttcaagggagaagagcgttcctggctggccaactttggatgcaat
cttttagaattctttaaggcgtataacgtaaaatttacgccctattatattgaaaattta
aaaaaacaggtagaacggctgccgggagagattaataaactgcaggaagaaagcccctcc
agcgatgaagcagcccaacggataaaaaatgccctgataaagaaacagcaggcgctggac
aatgccacagcagagttaaaacaatggagcgcggagaattttaataaacttacggatgag
caaaaacagctgttctataatgcatttgtaaacaataaaggcgataagaattaccgcagc
ctttcacaactgaaatacacggatggcggaaaggagcgtgtggtaaccgtacccgcggga
gatgttttttaccagttccgcaaagatgtggatgcaggcaagctgcctactgtttcctgg
tttgccggtcctcagaatttttctgatcaccccagcgcaccctggtatggcgcctggtac
gtttctgaaatactggacattcttaccaaaaaccccgaggtatggaaaaagaccattttt
attgttacctatgatgaaaatgacgggtattatgatcacgtgcccccgttttccatttgt
gataataacaagcccggtaccggtaaatgcagcgcaggtattgatacagaaatagaacat
gtgcgcctggagtatgagctgaagcagggcattgctaaaaaacaagcccgtgaggcaccg
gtaggcctgggcttccgggtacccatgatcatcgcctctccctggagccggggagggaaa
gtttgctcccagctttttgatcatacttccacattgcagttcttagaaacctttgtgaac
cagaagtacaaaaagaatattcactttgacaatatcagcgcctggcgccgtaccatctgc
ggggatcttactgcagcctttagcccgtttgacggcaaacctgtagaacgcgttcctttt
ctgaaaagagacgcttttgtggaaacgatcttcaacgcgcagtttaaacaggaaccgggc
aacttcaaccagctttcagcgggtgatttgcaaaaagtgattgaaaacccggcagcactt
gcctttatgccgcagcaggaaaaaggcacaaggccttcactctcgctgccgtatgagctg
tatgcagacgggaaattgtcaaaagacaaaaagcattttgaagtggtattgaaggcgggt
aaccagttctttggaaaaaaagcacagggatcgccttttacggcgtatgctcctgtaaac
tataaagaaggggatgccgcagaggtttgccgcaactggtcttttgccgtaaaggccggc
gatgcgctgcagtatgaatggcccgtacggtcatttgacaataacagctatcatttaagg
atccatggccctaacggcttttaccgcgaatttaaaggtactgctgatgacccggacttt
gagctgggttgcgcttatgaaacggacaataagggtaaacccaccgggaacctgttatta
aaactgaacagcagcgcgcctgttagtattgagattgctgataatgcctataaaaatgct
accctccggaagcaggtaagcggcgcccagaatgtagtgctgaacctggataaaagcggc
ggatggtatgatttttctgttaagataaccggcagcaatgcttttgaaaagcgctatgca
ggccgcgtggaaaagggcaccgacagcattacggatccttttatgggccgtgtggtataa

DBGET integrated database retrieval system