KEGG   Niabella ginsenosidivorans: A8C56_22715Help
Entry
A8C56_22715       CDS       T04418                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00511  Other glycan degradation
nia00600  Sphingolipid metabolism
nia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    A8C56_22715
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8C56_22715
Enzymes [BR:nia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     A8C56_22715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: ANH83418
UniProt: A0A1A9I6W6
Position
5380218..5381660
Genome map
AA seq 480 aa AA seqDB search
MYVMMKKRLWSLPAIGLALLFIQCNKKASPGKTNGPAEYDILHPDAWITKADQSALLQKT
DLSTAEVAGNSPVITIDTSRQYQTVDGFGYTLTGGSAVLINQLPAEKKQALLEELFGNNA
NAIGVSYLRLSVGASDLDSVTFSYNDLPAGETDVDQSKFSLAPDQSNLIPVLKRILAINP
AIKIIAAPWSAPAWMKDNNSTKGGSLKPDYYDAYATYFVKYIQAMQAEGITINAITPQNE
PYHPGNNPSLYMTATMQRDFIKNHLGPAFAKNNIRTKIVVYDHNLDKPLYADTIYQDPGA
SKYVDGAAFHLYAGEVSAMGQLHDRHPDKQLYFTEQWTGSREPFNTTLLWHIKNVIIGTL
HNWSKIALEWNLANDPSFRPHTPGGCTECKGAVTINGNSFTRNVSYYIIAHASKFIPPGA
RRIESAQVNGLSNVAFITPAGKKVLLVLNENVTPVSFKLQDGKAGAPISLPAGSVATLVW
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttatgatgaaaaaacgcttatggagcttaccggccatcggattggcgctttta
tttatccaatgtaataaaaaagccagccccggcaagaccaatgggccggcagaatatgat
atactccatccggacgcatggatcaccaaagcagaccagtctgctttgttacaaaaaaca
gatctgagcactgcggaggtagcaggcaatagcccggtgatcactatagatacgtcccgg
caatatcaaacggtagacgggtttggttatacgcttacgggcggcagcgcagtgctgatc
aaccaattgcctgcggaaaaaaaacaggcattgctggaagaattgtttggtaataatgcc
aatgctattggcgtcagttatctgcggttaagcgtcggcgcttctgacctggattctgtt
actttttcctataatgatcttcccgcgggggaaacagatgttgatcagtcaaaattcagc
ctggcgccggatcaatccaatctgatccccgttttaaagaggatcctggccattaatccc
gctataaagatcattgcagcgccctggagcgcccctgcctggatgaaagataataacagt
accaaaggcggatcactcaagccggattattatgatgcgtatgccacctattttgtaaaa
tacattcaggcaatgcaggcagaaggaattactattaatgccattaccccgcagaatgag
ccgtaccatcccggtaataatccaagcctttatatgacggctacgatgcaacgggacttt
ataaagaaccacctcggacctgcctttgcaaaaaataatatccggacaaagattgtggta
tatgatcataacctggataaacctctgtatgcggatacgatataccaggacccgggtgca
tcaaaatatgtagacggcgcggcctttcatttatatgccggggaggtaagcgccatgggg
cagctgcatgaccggcatccggataagcagctgtattttacggaacaatggaccggcagc
cgggaaccatttaacaccactttgctgtggcatataaaaaatgtgatcatcggcaccctg
cataactggagcaaaatagcattggaatggaacctggcaaatgacccttccttccggcct
catacgcccgggggctgtacagaatgcaaaggcgctgttaccataaacgggaactccttt
acacgcaatgtttcctattatatcatagcccatgcgtcaaaatttattccgccgggggcc
agaagaattgaaagcgcacaggtgaacggcctctccaatgtggcgtttataaccccggcc
ggtaaaaaagtattgctggtgctgaacgaaaatgtaacccctgtttcctttaagttgcag
gatggaaaggccggtgctcctatcagccttccggcgggttccgtagccacgcttgtctgg
tag

DBGET integrated database retrieval system