KEGG   Niabella ginsenosidivorans: A8C56_23610Help
Entry
A8C56_23610       CDS       T04418                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00511  Other glycan degradation
nia00520  Amino sugar and nucleotide sugar metabolism
nia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A8C56_23610
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8C56_23610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nia03110]
    A8C56_23610
Enzymes [BR:nia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A8C56_23610
Chaperones and folding catalysts [BR:nia03110]
 Intramolecular chaperones
  Others
   A8C56_23610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 TRAF6_Z2 Glyco_hydro_67N
Motif
Other DBs
NCBI-ProteinID: ANH83561
UniProt: A0A1A9IA60
Position
5577584..5579206
Genome map
AA seq 540 aa AA seqDB search
MLFALLCFHSALPAQNGIKLIPLPAILTARAGSFIIGNSTALVYNSRNAQLKAIARLFQD
HIKELSGIELNASSGRGSGSRIVFHIVPGAGLGNEGYTLNVARGQIDITAATASGIFYGV
QTLLQTLPAIRTNEPLQVPCMWVKDRPRFAWRGLMLDVSRHFFSPEMVKQLIDIMASFKM
NVLHWHLTDDQGWRIEIKKYPRLTSVGAWRMEKDEALFYQKDTAALKGKPSCRYGGYYTR
EQVKDIIAYAALRNISIVPEIEMPGHSGAALAAYPEYSCSGTPQPVPNTQLSGNFDWFHS
NYCPGNPATYTFLQNILTEVTDLFPSKYIHIGGDEVNKKDWKTCPRCQALMQKEQLKTEE
ALQSYFIRRMEQFIRSRGKRLIGWEEILEGDSLAPDAAVMSWIGEKRGIEAARKHHAVIM
CPGNPLYLNRHQTANSRYEAHAPSFSINTLEKVYAYDPLPAVLSTGEQQYVLGTQAVLWT
EFIKSVDQVQYMLFPRLCALAEIAWTPRAKQDFWSFKKRLKPRLTAFEQTGIRFFNKERF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgcgctactgtgctttcattctgccctgcccgcacagaacggaattaaattg
attcccctacctgcaatattgaccgccagggcgggctcttttataattgggaacagtact
gcacttgtgtacaacagcaggaatgcgcaattgaaagccattgcccgtcttttccaggat
catattaaagaattatcaggaatagaactgaacgccagttccggcaggggttccggctcc
cggatcgtttttcatattgtgcccggcgctggtttgggaaatgaagggtatacgctaaat
gttgctcgcgggcaaatagacattacagcggcaacagcctccggaatattttatggtgtt
cagaccctgttgcaaaccctgcccgccatccgcaccaatgagccgctgcaggtgccctgc
atgtgggtaaaagaccggccacgctttgcctggcggggtcttatgctggatgtaagccgt
catttcttttcaccggaaatggtgaaacagcttattgatatcatggcatctttcaaaatg
aatgtgcttcactggcatttaacagatgaccagggctggcgtatagaaataaaaaagtac
ccgcggcttacatctgttggcgcatggcgcatggaaaaggacgaagcgctcttttaccaa
aaagacaccgctgcactgaaaggcaaaccttcctgtagatatggcgggtattacacccgg
gagcaggtgaaagacattattgcttatgcggcattgcgcaacatttccatcgtgccggag
attgaaatgcccggtcattccggggccgcactggcagcctatccggaatattcctgctcc
ggcaccccgcagccggttcccaatacccagctttccggaaacttcgattggtttcattcc
aactattgccccggcaacccggccacttatacgttcctgcaaaatattcttaccgaggta
actgatctcttcccttcaaagtatattcatatagggggtgatgaggtaaataaaaaagac
tggaagacctgtccccgttgccaggcgcttatgcaaaaagaacagctgaaaacggaagaa
gcattgcaaagttatttcatccggcgtatggagcagttcatccgctccaggggcaaaaga
ttaattggctgggaagaaatactggaaggagacagtctggctcctgatgccgccgttatg
agctggatcggtgaaaaaagaggcattgaagcggccaggaaacaccatgctgtaattatg
tgccctggcaacccgctttatctcaaccggcatcaaacagccaatagccggtatgaggcc
catgcaccctccttctctattaatacattggaaaaggtgtacgcatacgatccgctaccg
gccgtactttcaaccggggagcagcaatatgtgctgggcacccaggcggttctgtggaca
gagtttatcaaatccgtagatcaggtgcagtatatgcttttcccccgcttatgcgcatta
gcagagatagcatggacgccccgggcaaagcaagacttttggtcgtttaaaaaaagatta
aaaccgaggcttactgcatttgaacaaaccggtatccgctttttcaataaggaaagattt
taa

DBGET integrated database retrieval system