KEGG   Nitrosopumilus piranensis: NPIRD3C_0419Help
Entry
NPIRD3C_0419      CDS       T03656                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nid  Nitrosopumilus piranensis
Brite
KEGG Orthology (KO) [BR:nid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NPIRD3C_0419
Enzymes [BR:nid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     NPIRD3C_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF520 GHL6 DUF5304
Motif
Other DBs
NCBI-ProteinID: AJM91635
UniProt: A0A0C5BXG8
Position
362878..363684
Genome map
AA seq 268 aa AA seqDB search
MKVAVVQFKASTNKETNLKKIISYIKKAASKNATLCAFPEFMMFYTNSTQTPKQLASLAE
TINGNFVKTIAKAAKENQIQVVGSFYEKSRKKDKVYDTSFVIDKSCKVISIYRKIHLYDA
LGFRESDKMASGSKIAKPVKTTLGKVGMMICYDLRFPEMSRSLAAAGSEILIAPSAWVKG
NMKEEHWITINKTRAIENGCYVIAPDQVGNIYCGRSLVVDPYGKVLLDMKKKQGIGYVNI
DLKKVKQTRKVLPLLKNRRTDVYPTLKA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgcagttgtacaattcaaagcatcaactaacaaagaaaccaatctaaaaaaa
attatctcctacatcaaaaaggcagcttcaaaaaatgcaactctttgtgcgtttccagaa
tttatgatgttttacacaaattctactcaaacaccaaagcaacttgctagtttagctgaa
accattaatggaaactttgtaaaaactattgcaaaggctgcaaaagaaaaccaaatccaa
gttgttggttcgttttatgaaaagagcagaaaaaaagacaaagtctacgacacttcgttt
gtaattgataaatcttgcaaggtgatctctatttatcgaaagattcacctctatgatgca
ttaggttttagagaatcagacaagatggcatcaggctcaaagattgcaaagcctgtaaag
actacattgggaaaagttggaatgatgatatgctatgacttacgttttccagaaatgtca
cgttcacttgcagcagctggctctgagatattgattgccccatcagcttgggtcaaaggt
aatatgaaagaagaacattggattacaattaacaaaacacgtgcaattgaaaatggatgc
tatgttattgcacctgatcaagttggcaatatctattgtggaagaagtctggttgtagat
ccatatggaaaagttttgcttgacatgaaaaagaaacaaggaataggttatgtcaatata
gatctcaaaaaggtaaaacaaacacgcaaagtactaccgttattaaaaaacagaagaaca
gatgtttatcctactttgaaggcctga

DBGET integrated database retrieval system