KEGG   Nitrosopumilus piranensis: NPIRD3C_0595Help
Entry
NPIRD3C_0595      CDS       T03656                                 

Definition
(GenBank) acetyl-CoA synthetase (ADP-forming)
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
nid  Nitrosopumilus piranensis
Pathway
nid00720  Carbon fixation pathways in prokaryotes
nid01100  Metabolic pathways
nid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nid00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NPIRD3C_0595
Enzymes [BR:nid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     NPIRD3C_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AJM91809
UniProt: A0A0C5BUD5
Position
494820..496916
Genome map
AA seq 698 aa AA seqDB search
MTESVVLSPKSIAVIGASDKRGSVGATITSNIMNGFKGTVYPISPSRDTVFYKKAYKSVL
DVPKPIDLAVIVIKNTLVAPVLEECGKKKIKGVIIITAGFKEVDEEGAKREQEIKDIAKK
YKIQVIGPNCLGVMNLDPKTMMNSTFLKITPKSGKIALVSQSGAICAALVEDASAQGIGF
SAVVSLGNKAVMSEVDVLKILANHKQTKVIVMYLEDMGNGQEFLKVCKNITKKLKKPVLV
LKSGRSPEGAKAAMSHTGALMGSDEIYDALLKQSGAIRVDTMEELFDYATAFSKQPLPSS
GDLVIVSNAGGPAIISTDACSKAKIKMADITSIRKKIDEVIPPWGSSRNPVDIVGDADFN
RFHNVLDRVLKHPKVGSVISMCTPSGTLDYDKLAEVIVDMSKKYKKTMLASLMGLDEGIT
NREILADGNVPYYTYAEGAIRTLAAMIRFSNWVKSSPGKITKFKVDKAKAKKIFDKVKKE
KRPNLLEEEGQEVLKAYGLPLPKSALAKNETEAVKIAKKIGYPIVMKIASPQIIHKSDAG
GVKVNITNDTEVKDAFKTIVKNAKRYNKKAEIKGVLIVEMVKGGKELIIGSKLEPGFGPV
IMLGMGGIYVEVLKDVTFKLAPVTDKEADDMIASIKTQKLLQGVRGEKPSDITKLSECIQ
RLSQLVSDFKEIKELDMNPVLVMEKGKGCRILDVRIGL
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatctgtcgttttatctccaaaatctattgcagtaattggtgcatctgacaaa
agaggaagtgttggagctactatcacatcaaacattatgaatggttttaaaggaacagtt
tatccaattagcccctcaagagatacggtattttacaaaaaagcatacaagagtgtttta
gatgttccaaaaccaattgatctagcagttattgtaatcaaaaatacattggttgcacca
gttctagaagaatgtggtaagaaaaaaatcaaaggagtaattatcatcacagctggcttc
aaagaagttgatgaagaaggggcaaaacgtgaacaagaaataaaagatattgctaaaaaa
tacaaaatccaagtaattggacctaattgtcttggtgtcatgaatcttgatccaaaaaca
atgatgaattcaacttttcttaagattacaccaaaatctggaaaaattgcacttgtatct
caaagtggagcaatttgtgctgcactagttgaagatgctagtgcacaaggaattggtttt
tctgctgttgtaagtcttggaaacaaagctgtaatgagcgaagttgatgttctaaaaatt
cttgcaaatcataaacaaactaaggtcattgtaatgtatcttgaagatatgggtaatgga
caagaattccttaaagtttgtaagaatattactaaaaaactcaaaaaaccagtacttgtt
ctcaaatctggacgtagtcctgaaggtgcaaaagctgcaatgtctcatactggggcattg
atgggctctgatgaaatttatgatgctcttctaaaacaatctggtgccattagagttgat
acaatggaagagttgtttgattatgcaacagccttctcaaaacaaccattgccatcaagt
ggtgatctagttattgtttcaaacgctggtggccctgcaattatctctacagatgcctgt
tcaaaagctaaaatcaagatggcagatatcaccagtattagaaaaaaaattgatgaggta
attccgccttggggaagttctagaaatccagttgatattgttggtgatgctgattttaat
agatttcataatgtactagatcgtgttcttaaacatccaaaagtaggttctgttatctct
atgtgtactccttctggaaccttagactatgataaacttgcagaagttattgttgatatg
tcaaaaaaatacaaaaagacaatgctggcaagtttgatgggattagatgaaggaattaca
aatagagaaattttagctgatgggaatgttccatattatacatatgcagagggtgcaatc
agaacgcttgctgcaatgattagattctctaactgggtaaaatcttctcctggtaagata
acaaaattcaaagttgacaaggctaaagccaaaaaaatatttgataaagtcaaaaaagag
aaaagaccaaatctcctagaagaagaaggtcaagaagttctcaaagcgtatggtttacca
cttcctaaaagtgcacttgctaaaaatgaaactgaagcagtaaagattgcaaaaaagatt
ggttatcctattgtaatgaagattgcatctccacaaattattcacaaatcagatgcaggt
ggtgttaaagttaatatcacaaatgatactgaagtaaaagatgcattcaaaaccattgtg
aagaatgcaaaaagatacaacaagaaagcagagatcaaaggtgttttgattgttgagatg
gttaaaggtggtaaagaactcatcattggttctaaactggaacctggatttggtccggtc
attatgcttggaatgggtggaatctatgttgaagttctcaaagatgttacattcaaactt
gctcctgttactgacaaagaagcagatgatatgattgcatcaattaaaactcaaaaactc
cttcaaggtgttaggggcgagaaaccatcagatatcacaaaactttctgaatgtattcag
agattatcacaattagtttctgactttaaagagattaaagaattagacatgaatcctgtt
ctggttatggaaaaaggaaagggatgtagaattctagatgtcagaataggcctctga

DBGET integrated database retrieval system