KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0141Help
Entry
Nit79A3_0141      CDS       T01569                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00740  Riboflavin metabolism
nii00790  Folate biosynthesis
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Nit79A3_0141
   00790 Folate biosynthesis
    Nit79A3_0141
Enzymes [BR:nii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Nit79A3_0141
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Nit79A3_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AEJ00048
UniProt: F8GFE8
Position
168825..169925
Genome map
AA seq 366 aa AA seqDB search
MRISAIQDIIDDLRLGKMVILIDEEDRENEGDLVLAADFVTPEAINFMATHGRGLICLTL
TEEKCHQLDLPLMVSANRAPLGTNFTLSIEAANGVTTGISAADRARTIQVAVKADAKPQD
IVQPGHIFPLMAQKGGVLVRAGHTEAGCDLARMAGMTAASVICEILKEDGSMARLPDLME
FALKHQLKIGAIADLIQYRSQTESLVTRVAERAIQTLHGEFLLTAYRDEIANTTHLALVK
GEINPTTETLVRVHEPLSVIDLLDIYDNTHSWSIHDAMKLIAEAGQGVIVLLHRKESPAK
LIERVQLKESRYPGSIKTDLRDHGIGAQILKDLNVGKMRLMSAPRKMPSVTGFGLEVTSY
VDTPKL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcagtgctatccaagatattattgatgatctgagattgggtaaaatggtcatt
cttattgatgaagaggatcgcgagaatgaaggagatctggttctggctgccgattttgtg
acgccggaggctatcaattttatggccacccacggtcgtggactgatttgtttaactctg
accgaggaaaagtgtcatcaattagatttgcctttaatggtgtcagccaaccgcgctccc
ttgggcaccaattttacgctttccatagaagccgcgaacggtgtaaccacgggtatttct
gccgctgaccgtgcacgcaccattcaagtcgccgttaaagcggatgccaagccacaagac
attgtacagccgggtcatatttttccattgatggcacagaaaggcggtgtcttggttcgc
gcgggtcatactgaagcgggttgtgatttagccagaatggccggtatgacagcagcctcg
gtgatttgtgagattctgaaagaagacggcagcatggcgcgattgccggatcttatggag
tttgcgcttaaacatcaacttaaaattggcgcgatagccgatctgattcaatatcgcagt
cagactgaaagcttggtaacgcgtgttgctgagcgtgcaattcagacactgcatggcgaa
tttctactgacagcttatcgtgatgaaatagccaatacaacacacttggctttagttaaa
ggtgaaataaacccaacaactgaaaccttggtgcgcgtgcatgaaccgctgtcagtcata
gatctgctggatatttatgataatacgcattcctggagcattcatgatgccatgaagttg
attgctgaagcggggcaaggtgttattgttctactacatcgcaaagaaagcccagctaaa
ttgattgagcgcgttcaattgaaggaatcgcgttatcccggctcgatcaagacggatctt
cgtgatcacggtattggcgcacaaatactgaaagatcttaacgtaggaaaaatgcgattg
atgtcagcgccgagaaaaatgcccagtgtgacaggattcggtttggaagtaaccagttac
gtggatacgcccaaactataa

DBGET integrated database retrieval system