KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0365Help
Entry
Nit79A3_0365      CDS       T01569                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00071  Fatty acid degradation
nii00280  Valine, leucine and isoleucine degradation
nii00310  Lysine degradation
nii00362  Benzoate degradation
nii00380  Tryptophan metabolism
nii00620  Pyruvate metabolism
nii00630  Glyoxylate and dicarboxylate metabolism
nii00640  Propanoate metabolism
nii00650  Butanoate metabolism
nii00900  Terpenoid backbone biosynthesis
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
nii01212  Fatty acid metabolism
nii02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nit79A3_0365
   00630 Glyoxylate and dicarboxylate metabolism
    Nit79A3_0365
   00640 Propanoate metabolism
    Nit79A3_0365
   00650 Butanoate metabolism
    Nit79A3_0365
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nit79A3_0365
   00072 Synthesis and degradation of ketone bodies
    Nit79A3_0365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nit79A3_0365
   00310 Lysine degradation
    Nit79A3_0365
   00380 Tryptophan metabolism
    Nit79A3_0365
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nit79A3_0365
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nit79A3_0365
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Nit79A3_0365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nii04147]
    Nit79A3_0365
Enzymes [BR:nii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nit79A3_0365
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nit79A3_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ00252
UniProt: F8GH86
Position
393830..395008
Genome map
AA seq 392 aa AA seqDB search
MRDVVILSGVRTAIGDYGGALKNAAPADLASKVVQEAVLRAGIDPDAVGHLVFGNVIHGE
SRDMYLARVACINGGLAQHTSALTVNRLCGSGLQAIISASQNILLNDTDVAVAGGAESMS
RGGYLLPALRWGQRMNDGGTVDMMIGALTDPFDNVHMGITAENIAAKWQISREVQDTFAA
ESHRRALHAIRNGYFKEQILPIEITTHKEKIRFDTDEHPRENTSMETLSKLRPVFQEDGT
VTAGNASGINDSAAAVVLMESKAAQRCDLKPLARLVSYGHAGVDPKFMGIGPVPAVQKAL
RRANLKIADIDVIESNEAFAVQACAVAKELQFDPEKTNPNGGAVALGHPIGATGSILTIK
AIYELHRCGGRYALVTMCIGGGQGIAAILERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgttgtcattctgagtggcgtgcgcacggccatcggtgattacggcggcgca
cttaaaaatgctgctcctgcagatttggcgtcaaaggtcgtgcaggaagcagtattacgc
gccggaattgatccagatgctgttgggcacctggtttttggcaatgtaatacacggagaa
tctcgcgatatgtatttagcgcgcgttgcttgtattaatggcggcttagcgcaacacact
tcagcgctgacagtgaaccggctgtgtgggagcggtctacaagccatcatctcggcaagt
caaaatattctgctaaatgacaccgatgtggcagttgccggtggcgctgaatccatgagt
cgaggaggatatttgttacctgccttgcggtgggggcaacgcatgaatgatggtggtacc
gtagatatgatgatcggggcattgaccgatccattcgataacgtgcatatgggcattact
gccgagaatattgccgctaaatggcaaatcagccgtgaagtacaagatacatttgcggca
gaaagtcatcggcgtgccctacatgcgataaggaatggttattttaaagagcaaatattg
cctattgaaataacgacacataaagaaaaaatccgttttgatacggacgagcatccccgt
gaaaacacaagtatggagactctgtcaaagcttcgtcctgtttttcaagaagatggcacg
gtaacggcaggcaatgcctccggtattaatgatagtgccgccgcagtggtgctcatggaa
agtaaagcagcgcagagatgcgacttgaaaccgttggcgcgactggtttcttatggtcat
gccggtgttgatccaaaatttatgggcatcgggccggtgccggctgttcagaaagctttg
cggcgtgcaaatcttaaaatagcagatattgatgtcattgaatccaacgaggcctttgct
gtgcaagcttgtgctgtagcaaaagaactgcaatttgatccagaaaaaaccaatccgaat
ggtggtgctgtcgcattgggtcatcccatcggtgcaactggcagtatcttgacgattaag
gctatttatgaattgcaccgatgcggcgggagatatgcattggtgaccatgtgcatcggt
ggcggccaggggattgctgcaatattagaaaggctatag

DBGET integrated database retrieval system