KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0903Help
Entry
Nit79A3_0903      CDS       T01569                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00130  Ubiquinone and other terpenoid-quinone biosynthesis
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Nit79A3_0903
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Nit79A3_0903
Enzymes [BR:nii01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Nit79A3_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEJ00773
UniProt: F8GLM7
Position
993444..994058
Genome map
AA seq 204 aa AA seqDB search
MKNSQTITLALTGASGMPYGIRLLEMLLREGKQVYLLYSKVAQIVAQQEMNLALPSSAKE
AEAFFNRQYNAPDGQLRVFGREEWFAPVASGSNPADSMVICPCTMGTLAAIAAGMNQKLI
ERAADVMLKENRQLILVPREMPFSAIHLENMLKLVRSGAVILPANPGFYHHPQTVQDMID
FVVARILDHLGIIHTMIPRWGTES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattctcagacgattactttggcattgaccggcgcatctgggatgccttatggg
attcgtttgcttgaaatgttgttgcgggaaggaaagcaagtatacctcctgtattcaaaa
gtagcgcaaattgttgcacagcaggaaatgaacttggcactgccttccagtgctaaggaa
gcggaagctttttttaatcgccagtacaatgctccggatggacagttgcgtgtatttgga
cgtgaggaatggtttgcgccagttgcttccggctctaatccggcggattcgatggtgatt
tgtccctgtaccatgggtaccttggcagctattgccgcaggtatgaatcagaaactgatt
gagcgggcagcagatgtcatgttgaaggaaaatcgccaacttattttagtgccacgggag
atgccgttttctgcaattcatttggaaaatatgctcaagctggtgcgtagcggtgccgtt
atcctaccggcgaatcccggtttttatcatcacccgcagacggtgcaggatatgattgat
tttgttgttgctcgtattttggatcatctggggatcatacataccatgattcctcgttgg
ggaacagaaagctga

DBGET integrated database retrieval system