KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1687Help
Entry
Nit79A3_1687      CDS       T01569                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00020  Citrate cycle (TCA cycle)
nii00640  Propanoate metabolism
nii00660  C5-Branched dibasic acid metabolism
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
Module
nii_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nii_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nit79A3_1687
   00640 Propanoate metabolism
    Nit79A3_1687
   00660 C5-Branched dibasic acid metabolism
    Nit79A3_1687
Enzymes [BR:nii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nit79A3_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A FbpA
Motif
Other DBs
NCBI-ProteinID: AEJ01502
UniProt: F8GIK0
Position
1804253..1805428
Genome map
AA seq 391 aa AA seqDB search
MKIHEYQAKEILRKYGVVTPKGIACFSVDEAVKAAQQLGGEVWAVKAQIYAGGRGKGGGV
KVARSLDEVRQRAGEILGMRLVTHQTGPEGQIVHRLFIEQGVHIEKEFYVGMVIDRGRQR
VCLMASSEGGMEIEKVAAETPEKIHKVFIDPIAGLSQQQAEEVALKIGIPAQSVPQAVTL
LQGLYQAFDDTDSSLLEINPLTLTAEKQVIALDAKMNFDDNALFRHPEIVALRDLDEEDP
VEIEASKHELSYIPLDGNIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATAEKVTE
AFKLMLRNPKLQAILVNIFGGIMKCDVIAQGVVAAAREVQLTVPLVVRLEGTNVDLGKKI
LADSGLTIISAENMADAAQKAVSAAKTKSSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaggcaaaagagattttgcggaaatatggggttgttacgccg
aaaggcattgcttgtttcagtgttgacgaagccgtgaaagctgcgcagcaactgggtggt
gaggtgtgggcggtgaaggcgcagatttatgccggcgggcgcggtaagggcggtggggtg
aaagttgctaggtcgttggatgaggtgcggcaacgtgcgggggagattctgggcatgcgg
ctagtgacgcatcagaccggcccggaagggcagatcgtgcatcggctttttatcgaacag
ggtgttcatatcgagaaagaattttatgttggcatggtgatcgaccgcggccgtcagcgc
gtgtgcctgatggcaagttcggaaggcggcatggagatcgaaaaagtcgcggctgaaacg
ccggagaaaattcataaagtgtttattgatccgattgcggggctcagtcagcagcaagcc
gaggaagttgcattaaaaatcggcattcctgcgcaaagtgtgccgcaagcggttacgttg
ttgcaaggtctgtaccaggcttttgatgacaccgattcgtcgttgctggaaattaatccg
ctaacgttaactgctgagaaacaggtgattgcgctcgatgccaaaatgaattttgacgac
aatgccttgtttcgtcatccggagattgtcgcgctgcgcgatctggatgaggaagacccg
gttgagattgaggcatccaaacacgagttatcgtacattccattggatggcaatatcggc
tgcctggtgaatggtgcgggactggcgatggcaacgatggatatcattaaattgtacggc
ggcaatcctgcgaatttcctcgatgtcggcggcggcgcgacggcggagaaggtgaccgag
gcgtttaagttgatgctgcgtaatcccaagttgcaagcgattctggtgaatattttcggc
ggcatcatgaaatgcgatgtgattgcgcaaggtgtggtggcagcagcgcgcgaggtgcag
ttgaccgtgccgttagtggtgcgcctggagggcaccaatgtggatctcgggaaaaagatt
ctcgccgattccggtttgacgatcatctcggcggaaaacatggccgatgcagcgcagaaa
gcagtcagcgcggccaaaaccaagtcatcgtcgtga

DBGET integrated database retrieval system