KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3102Help
Entry
Nit79A3_3102      CDS       T01569                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01130  Biosynthesis of antibiotics
nii01230  Biosynthesis of amino acids
Module
nii_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nit79A3_3102
Enzymes [BR:nii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nit79A3_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEJ02840
UniProt: F8GK30
Position
3281915..3282751
Genome map
AA seq 278 aa AA seqDB search
MPDILKKILAVKKQEIMAATALKPYPLLLQEARSVSPPRDFVAAIRNKINVGQSAVIAEI
KQASPSKGILRGCSSDTNAQSFEFLPAEIAKTYAQHGAACLSVLTDKQFFMGSSEYLQEA
RAACTLPVLRKDFILEDYQVTEARAMNADCILLIVSAFLLENIEPVMRMLKLEELANSLG
MAVLIEVHDANELEMALQLNTPLIGINNRNLRTFETSLNTTLELLNQIPSSKIVVTESGI
HSPADVALMRSQHVNAFLVGEAFMRAEDPGIELKRLFF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatatcttaaagaaaatccttgcagtaaaaaaacaagaaattatggctgccacg
gcattaaagccctatccattattactccaagaagcccgatccgtatccccaccgcgcgat
ttcgttgcagcaattcgtaacaaaatcaatgtagggcaatccgctgttattgctgaaatc
aaacaagccagtcccagcaaagggatattacgcggatgctcctctgacaccaatgcacaa
tcgtttgaatttctgcctgccgagatagccaaaacttatgcgcaacatggtgcagcttgt
ctgtcagtattgactgataaacaattttttatgggaagctctgaatatttgcaagaggcg
cgcgcagcctgcacgcttcccgttctacgcaaagatttcattcttgaggattatcaggtt
actgaagcgcgcgctatgaatgcggattgtattttgctgatagtcagtgcttttttgcta
gaaaacattgaaccggtaatgcgtatgctgaagcttgaagaactcgccaattcgcttgga
atggccgttctgattgaagttcatgatgcaaatgaattggagatggcactccagctcaat
acaccgttaatcgggatcaataaccgcaacttacggacttttgaaacctctttaaatacc
actctggaattattgaatcaaattccatccagcaaaatagtcgttacggaaagcggtata
catagtcctgccgatgttgcactgatgcgcagtcaacacgttaatgcatttcttgttggt
gaagctttcatgcgcgctgaagatccaggcattgaattaaaaaggttatttttctga

DBGET integrated database retrieval system