KEGG   Candidatus Nitrospira inopinata: NITINOP_2240Help
Entry
NITINOP_2240      CDS       T04169                                 

Gene name
putA
Definition
(GenBank) Bifunctional protein PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nio  Candidatus Nitrospira inopinata
Pathway
nio00250  Alanine, aspartate and glutamate metabolism
nio00330  Arginine and proline metabolism
nio01100  Metabolic pathways
nio01110  Biosynthesis of secondary metabolites
nio01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NITINOP_2240 (putA)
   00330 Arginine and proline metabolism
    NITINOP_2240 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nio03000]
    NITINOP_2240 (putA)
Enzymes [BR:nio01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     NITINOP_2240 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     NITINOP_2240 (putA)
Transcription factors [BR:nio03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    NITINOP_2240 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: CUQ67212
UniProt: A0A0S4KRZ3
Position
1:complement(2176385..2179351)
Genome map
AA seq 988 aa AA seqDB search
MTPVSSHEPESLEPAVRRIGGHLVRLSAGHKPTVFEGRWWSQSAINLAMKDPVFKTRLFR
FIDVLPSVADDERVVSLAQEYFGGLHADLFGLQWGLKALAATGLGARWTGKSIRAHVEQM
ARTFIAGASVDEAVPVLQHLWKAGRAWSVDLLGEATVSESEADLYRDRCLQTLRELARTA
SSWPSAPLLESDHLGPLPRVQLSIKISALSSRLDPIDPDGSYRSVASRLRPLVDQAVSLS
AGLIFDMEQAETKPLLLDIFTRLFAEPAYRGYPYAGLALQAYHRDTERDVRRLIAWTKTR
GAPITIRLVKGAYWDSDTVRYRQAGWPVPLFEHKAETDANYERLIRLLFDHAEFVRPAFG
THNLRTLSVIEAVADSRNLPAAAREYQMIYGMAEPFQQAMVTLGRRVRLYTPVGRLLPGM
AYLVRRLLENTSNESFLRKEYVESQSLAQLLAPPEVPPVEVETPAATDRRTFSNEPHSDF
SRAEVRQAMRDGLASVRAQLGRRWESIGPDLKPTGPWLVSHNPFKPEEVVAEVKGASVAD
LDRAVQRAEAAFEDWRRRPAEERAAVLDRAADEIARRRYELAAWEVFEVGKPWREADADV
AEAIDFLRYYSREMRRLANPMKLGERPGEINHRLYSPRGVAAVIAPWNFPLAIPAGMVAA
ALVTGNAVLFKPSERAPLLGMLLSELLTSAGVPSDALICIPGGPEIGRALVIHPHIVTIA
FTGSKAAGLHILSEASVVRPGQPMVKRVIAEMGGKNAIIVDDTADLDEAIVGVVASFTGY
AGQKCSACSRALVHRSVYDEFVGRLKDAVLSLEIGDPADPGTRMGPVIDARAQASIQRFI
AEGLRECRPLVQRSVDREGYFIGPTVFVDVEPTHRLAQKEIFGPVLAVMKAESFEEALRL
ANGTSYALTGGVYSRSPANLALARDRFDVGNLYLNRPITGALVGRQPFGGHRFSGVGAKA
GGEDYLPQFMTARIVCENTLRRGFEAVE
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgtttcatcgcacgaaccggaatcgctcgaaccggccgttcgccggatcggc
gggcaccttgtccgcctctccgccggccacaagccgaccgttttcgagggccggtggtgg
tcccagtcggcgatcaatctcgccatgaaggacccggtcttcaaaacccgtctctttcgc
ttcatcgacgtcctgccatcggtcgccgatgatgagcgcgtcgtctctctcgctcaagaa
tatttcggtggattacacgccgacttattcggtcttcaatggggactcaaagcgttggcg
gccaccggcctcggcgccaggtggaccggcaagtcgatcagggctcatgttgaacaaatg
gcccgaacgtttatcgcgggtgcgtcggtggacgaagcggtgccggtcttgcaacacctt
tggaaggccgggagggcctggtccgtcgatcttctgggagaagcgacggtcagcgaatca
gaagccgatctctaccgagaccgttgtctccaaacgttgagagagctggcgcggacggct
tcttcctggccatcggcccctcttttggaatcagaccacctggggccgctgccgcgcgtg
caactctccatcaaaatctcggcgctctcctctcgcttggacccgatcgatcccgacggc
agctatcggtcggtggcgtcgcgccttcgccccttggtcgatcaagccgtctcactgtcg
gccgggctgattttcgacatggaacaggccgagaccaagccccttttgctggacatcttc
actcggctgttcgccgaaccggcctatcgcggctatccctacgccggtctcgccctgcag
gcctatcatcgggacactgaacgggacgtccgccgtctgatcgcctggaccaagacgcgc
ggcgcgccgatcacgattcggttggtcaagggcgcctattgggactcggatacggtccgg
tatcgacaggccgggtggccggttccgctcttcgaacacaaggcggaaacggacgccaac
tacgaacggctgattcgtctcctcttcgaccatgcggagttcgttcgcccggcgttcggc
acgcacaatctgcggacactgtccgtcatcgaggccgtggcggacagccgtaacttgccg
gccgccgcgcgggaatatcaaatgatctacggcatggccgagccctttcaacaggccatg
gtcacgctggggcgccgagtccgcctctacaccccggtcggccggctcttgccgggcatg
gcctacttggtccgtcgtctgttggaaaacacgtccaacgaatcgtttctccgtaaagaa
tacgtcgaatcccagtcgctggcgcagcttctggctccgcccgaggtcccgccggtcgag
gtggaaacgccggccgcaaccgaccggcgaacgttctccaatgagccgcacagcgatttt
tcccgggccgaggtccgtcaagccatgagggacggcctggcgtcggtgcgggcgcaactc
ggacggcgatgggaatcgatcggaccggatttgaaaccgacgggtccctggctcgtgtct
cacaatccgttcaaacccgaagaagtcgtcgcggaggtgaaaggcgcatccgtcgcggat
ctcgaccgagccgtccaacgggcggaggcggccttcgaggattggcggcggcgcccggcc
gaggaacgggccgccgtcttggacagggccgccgatgagatcgcgcgacggcgttacgaa
ttggccgcctgggaagtcttcgaggtcggcaaaccgtggagggaagcggacgccgacgtc
gccgaggcgatcgattttctccggtactatagccgggagatgcgccgcctggccaacccg
atgaagctgggcgagagaccgggggaaatcaaccaccgactgtacagcccgcgcggcgtc
gccgccgtcatcgccccgtggaattttcccctcgccatcccggccggcatggtcgccgcc
gccttggtcaccggcaacgccgtcctcttcaaaccgtcggagcgggcccctctgttggga
atgctcctctcggagcttctgacgtccgccggagtgccgtcggacgcgctcatctgcatc
ccgggaggaccggagatcggacgcgccctcgtgattcaccctcacattgtgacgatcgcc
tttacgggatcaaaagccgccgggcttcacatcctatccgaagcctccgtcgtgcggccg
ggacaaccgatggtcaaacgggtgatcgccgagatgggaggcaaaaacgcgatcatcgtc
gatgacacggcggatttggacgaagccattgtcggcgttgtggcttccttcacgggatac
gcggggcagaaatgttcggcctgctcccgggccctcgtgcatcgctcggtgtacgacgag
ttcgtaggccgattaaaggacgccgtcttaagcctggaaatcggcgatccggcggacccc
ggcacccggatgggaccggtcatcgacgcgcgggcgcaggcctcgattcaacggttcatc
gcggaggggctgcgcgagtgccgaccgctggttcagcgatcggtcgatcgggaaggatac
ttcatcggcccgacggtcttcgttgacgtagaaccgacccaccggttggcgcagaaagag
atcttcggtcccgtgctcgccgtgatgaaagcggagagtttcgaggaggcgctgcgtctg
gcgaacgggacgtcttacgcgctgacgggcggtgtgtacagccggagtccggcgaatctc
gccctcgcccgcgaccgattcgacgtcggcaatctctatctgaatcggccgatcaccggc
gcgctcgtcggacggcaacccttcggcggccatcgtttttcaggggtgggggcgaaagcg
ggaggggaagactacttgccccagttcatgaccgctcgcatcgtttgcgaaaacaccctc
cgccggggattcgaggccgtcgagtga

DBGET integrated database retrieval system