KEGG   Candidatus Nitrosopumilus sediminis: NSED_00830Help
Entry
NSED_00830        CDS       T02303                                 

Definition
(GenBank) CoA-binding domain-containing protein
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00720  Carbon fixation pathways in prokaryotes
nir01100  Metabolic pathways
nir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NSED_00830
Enzymes [BR:nir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     NSED_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 ATP-grasp Dak1_2
Motif
Other DBs
NCBI-ProteinID: AFS81978
UniProt: K0B782
Position
142006..144102
Genome map
AA seq 698 aa AA seqDB search
MAESVFLSPKSIAVIGASDKRGSVGATITSNIMNGFKGTVFPISPSRDTVFYKKAYKSVL
DVPKSIDLAVIVIKNTLVAPVLEECGKKKVKGVIIITAGFKEVDEEGARREQEIKDIAKK
YKIQIIGPNCLGVMNLDPKTMMNSTFLKVTPKSGKIALVSQSGAICAALVEDASAQGIGF
SAVVSLGNKAAMSEVDILKILANHKQTKVIVMYLEDMGDGQEFLKVCKNITKKLKKPVLV
LKSGRSPEGAKAAMSHTGALMGSDEIYDALLKQSGAIRVDTMEELFDYATAFSKQPLPTA
GGLVIVSNAGGPAIISTDACSKAGIRMAKIDSIRSKIDEVIPPWGSSRNPVDIVGDADFN
RFHNVLDRVLKHPKVGSVITMCTPSGTLNYDKLAEVIVEMSKKYKKTMLASLMGLDEGIT
NREILSKGDVPYYTYAEGAIRTLAAMIKFAIWVNTKEGRITKFKVNKAKAKKIFDKVKKE
KRPNLLEEEGQEVLKAYGLPLPQSALAKNETEAIKIAKKIGYPVVMKIASPQIIHKSDAG
GVKVNLNNDAEIKDAFKTIIKNAKKYNKNAEIKGVLIVEMVKGGKELIIGSKLEPGFGPV
IMLGMGGIYVEVLKDVTFKLAPVTDKEADDMIASIKTQKLLQGVRGEKPSDITKLSECIQ
RLSQLVSDFKEIKELDMNPVLVMEKGKGCRILDVRIGL
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatctgtctttttatcaccaaaatcaattgcagtaattggtgcatctgacaag
agaggaagtgttggagctacaattacgtcaaatattatgaacggtttcaaaggaactgtt
tttccaattagtccctcaagggatactgtcttttacaaaaaagcatacaagagtgtttta
gatgttccaaaatcaattgatcttgcagtaatcgtcattaaaaatacgttagttgcacca
gtgttagaagaatgtggaaagaaaaaagtcaaaggcgttatcattatcacagctggcttc
aaagaagttgatgaagaaggagctagacgtgaacaagaaataaaagatattgctaaaaaa
tacaaaatccaaatcatcggacctaattgtcttggtgtcatgaatcttgatccaaagaca
atgatgaattctacttttcttaaagttacaccaaagtcaggaaaaattgcattggtatct
cagagtggcgcaatctgtgcagcactagttgaagatgcaagtgctcaaggaattggtttt
tctgctgttgtaagtcttggaaataaagctgcaatgagtgaggttgacatcctaaaaatt
cttgcaaatcataaacaaaccaaagttattgtgatgtatcttgaagacatgggagatggt
caagaattcctcaaagtttgtaaaaatattactaaaaaactcaaaaaaccagtacttgta
ctaaaatctggacgtagtccagagggtgcaaaagctgcaatgtctcatactggagctttg
atgggttcagatgaaatctatgatgctcttcttaaacaatcaggcgcaatcagagttgat
actatggaagaattatttgattatgcaacagcattttcaaaacaaccacttccaacagca
ggtggtttagttattgtatcaaatgctggagggcctgcaataatttccactgatgcatgt
tctaaagctggaattagaatggcaaagattgatagtattcgttcaaagattgatgaagta
attcctccttgggggagctctagaaacccagttgacattgtaggtgatgctgattttaac
agattccataacgtgttggatcgtgtactgaaacatccgaaggtaggatctgtgattact
atgtgtacaccttctggaactctgaattatgataaacttgctgaagttattgttgaaatg
tcaaagaaatacaaaaaaacaatgcttgcaagcttgatgggattggatgaaggcattaca
aatagagaaattttatccaaaggagatgttccttattacacatacgctgaaggagcaatt
agaactttagctgcaatgataaagtttgcaatttgggtaaataccaaagaaggaagaatc
acaaaattcaaagtaaacaaagctaaagcaaagaaaatttttgacaaagtcaaaaaagaa
aaaagacccaatctgttagaagaagaaggacaagaagttctcaaagcatatggcttaccc
ttgcctcaaagtgcacttgccaaaaatgaaacagaagcaataaaaattgccaaaaaaatt
ggttatcctgttgtaatgaaaattgcatcacctcaaattattcacaagtctgatgctggt
ggtgttaaagtaaacttgaacaatgatgctgaaatcaaagatgcattcaaaaccattatc
aaaaacgccaaaaaatacaacaaaaatgcagagatcaaaggagtcttgattgtagagatg
gtaaaaggtggcaaagaactcattattggttcaaaacttgaaccaggatttggtcctgta
attatgcttggaatgggtggaatctatgtcgaagttcttaaagatgtaacattcaagctt
gcacctgtaactgataaggaggctgatgatatgatagcctcaattaaaactcaaaaacta
ctacaaggtgtgagaggagaaaaaccatctgatatcacaaaattatctgagtgtattcaa
agactatcccaattagtttctgactttaaagagattaaagaattagacatgaaccctgtt
ctagtaatggagaaaggaaaaggctgtagaattcttgatgtcagaattggactttga

DBGET integrated database retrieval system