KEGG   Candidatus Nitrosopumilus sediminis: NSED_02565Help
Entry
NSED_02565        CDS       T02303                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00860  Porphyrin and chlorophyll metabolism
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01120  Microbial metabolism in diverse environments
Module
nir_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NSED_02565
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     NSED_02565
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     NSED_02565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M IlvN Shikimate_DH Herpes_BLRF2 F420_oxidored TrkA_N Pyr_redox_3 Oxidored_nitro XdhC_C CysG_dimeriser CtnDOT_TraJ
Motif
Other DBs
NCBI-ProteinID: AFS82321
UniProt: K0BD86
Position
complement(431904..432557)
Genome map
AA seq 217 aa AA seqDB search
MIVDLNLQDKKIIVIGGGNEAQKRVNSIINQGCNITVISDSVNSQISKLSKAKKITLKKQ
KISDTKFLSELKPNLVITTTNDRKINQKIINDAKKEKIMAYSSDNPDDSDFSNPAIIDFE
NMIQIAIFTGGRSPAMSKKIKDRSEKLFKKIITKEDIAQIKIQNKIRDMAKETISTQEQR
RECLRSIISDNEIDQLIKDKQFKKAEKRAITILRNWK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgacctgaatctccaagataaaaaaataattgtcatagggggaggaaatgaa
gcccagaagagagtcaattctattattaatcaaggatgcaacattacagtaatcagcgat
tcagtaaattcacaaattagcaaattatccaaagccaaaaaaattacattaaaaaaacaa
aaaatttcagatacaaaatttctttcagaacttaaaccaaatttagtcatcacaacaaca
aatgacagaaagattaatcaaaaaatcatcaatgatgcaaaaaaggaaaagatcatggca
tacagttcagacaatcctgatgacagcgacttttcaaatccggccataattgattttgaa
aatatgattcagattgcaatttttactgggggaaggagtcctgcaatgtcaaagaaaatc
aaagatagatcagagaaattattcaaaaaaatcatcaccaaagaagatattgctcaaatt
aagatccaaaataagataagagatatggccaaagagacaatatctactcaagaacaaagg
agagaatgtctacgtagtatcataagtgataatgagattgatcagttaataaaagacaag
cagttcaaaaaagctgaaaagcgagctatcacaatattgaggaattggaaatga

DBGET integrated database retrieval system