KEGG   Candidatus Nitrosopumilus sediminis: NSED_05130Help
Entry
NSED_05130        CDS       T02303                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00260  Glycine, serine and threonine metabolism
nir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01130  Biosynthesis of antibiotics
nir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NSED_05130
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NSED_05130
Enzymes [BR:nir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NSED_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth DHO_dh FMN_dh IMPDH BtpA PcrB NanE ThiG IGPS TMP-TENI G3P_antiterm Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AFS82830
UniProt: K0BCT6
Position
840723..841523
Genome map
AA seq 266 aa AA seqDB search
MSRIKEKFSELQARNQKALISYIMAGFPNEKATISTIRGLVKGGVDIIEIGFPFSDPLAD
GPVIQNASTVSLEKGTKIAKFFNLVKKIRKETDIPLILMTYTNILYHKGYAKFIVEAKRA
GIDGFILPDMSIEESKEYLKAAKNNADTIFLISPNTSKTRIQKISKVTSGFLYLVAVFGT
TGIKTGIKKYTIDAIKQVKKQTKGKIPVGVGFGVSTPDDVKKYIKAGADAVIVGSAYLKL
IEKTPQNQLESKIASFTKSLKKQTIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaattaaagaaaagttttcagagttacaggctagaaaccaaaaagctctgata
tcatacattatggcagggtttccaaacgagaaagcaaccatatccaccattagaggattg
gtcaagggaggagtagatatcatagagattggatttccattttcagatcctctagctgac
ggaccagtcattcagaatgcaagtacagtatccctagaaaaaggaacaaagattgcaaag
tttttcaatcttgtaaaaaaaataagaaaagaaacagacatcccccttattctaatgaca
tataccaatattttgtaccataaaggatacgcaaaattcattgtagaagcaaaaagagca
ggtatcgatggttttattcttccagacatgtcaatagaagagtcaaaagaatacttgaag
gcagcaaagaataacgcagatacaatattcttaatttctccaaatacaagcaaaacaaga
attcagaaaatatctaaggtaacatcagggtttttgtatctggttgcagtatttggcact
acaggaataaaaacaggaattaaaaaatatacaatagatgcaatcaagcaagtcaaaaaa
cagaccaagggaaaaattccagtaggggtcggatttggagtttcaacaccagatgacgta
aaaaaatacatcaaagcaggggcagatgccgtaattgtcggaagtgcatatttgaaattg
attgaaaagaccccacaaaatcaactagagtcaaaaattgcatcatttacaaaaagtctc
aaaaaacaaacaatcctttag

DBGET integrated database retrieval system