KEGG   Candidatus Nitrosopumilus sediminis: NSED_05965Help
Entry
NSED_05965        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3883 Nucleoporin_FG VRR_NUC
Motif
Other DBs
NCBI-ProteinID: AFS82995
UniProt: K0BD85
Position
complement(990459..991100)
Genome map
AA seq 213 aa AA seqDB search
MGFFDTFKKSRKQVNRENQEQGKIGERRIKEEYEFSGYKVKRTGKGHDLKAEKKDWLTGK
KETKYIEVKTGNSKLSKLQKKKRGYLGKKYVVERLEPTLLGLVSNNRESDKSKKRKKKDR
SSSLGFGNVSFWSDDFEAKKKTKKKSITKKKSTKKKSDSIWGSNSSMDSIFGSTKTKKKT
NQRKITKKKSHRKKKTTDIWGSTNTRRKNIVIW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgggattctttgacacattcaaaaaaagtagaaaacaagtaaaccgagaaaatcaagaa
caaggaaaaataggagaaagaagaatcaaagaagagtacgaattttcaggctacaaagta
aaacgaaccggaaaaggtcatgatctaaaggcagaaaaaaaagattggttgactgggaaa
aaagaaacgaaatacattgaagttaaaactggaaattcaaaactatctaaacttcaaaag
aaaaaacgaggttacttaggtaaaaaatatgtggtagaacgtcttgagcctaccctttta
ggattagtgtcaaacaatcgagagtctgacaagtccaagaaaagaaagaaaaaagaccgt
tcaagttctcttggatttggaaatgttagtttttggagtgatgattttgaagcaaaaaag
aaaactaagaaaaaatctattacaaaaaagaaatctactaaaaagaaatctgatagtata
tggggttctaacagttctatggattcaatcttcggttctacaaaaactaaaaagaaaact
aaccaaagaaaaattacaaagaaaaaatcccatagaaaaaagaaaactactgatatttgg
ggttcaactaatacaagaaggaaaaatatcgtgatatggtag

DBGET integrated database retrieval system