KEGG   Candidatus Nitrosopumilus sediminis: NSED_05985Help
Entry
NSED_05985        CDS       T02303                                 

Definition
(GenBank) RelA/SpoT domain-containing protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RelA_SpoT NEXCaM_BD DUF4709
Motif
Other DBs
NCBI-ProteinID: AFS82999
UniProt: K0BC11
Position
complement(994121..995107)
Genome map
AA seq 328 aa AA seqDB search
MFIPPNTASLKSEYAKKIGTYQYLISKIKTLLNEDLLTKEIKIISLTAREKKFDSFYKKI
FRYEIEGDYFVKIDDLAGVRIVCVYLEEMEKIRNIIQKNFQIIREKHLNFDNRVDKTGYQ
SDHYIVKLKKESVTNADKFLHSDIGNCLCEIQVRTALMHSWSSVSHDLFYKKKLVESDFE
REMYALSSLFFFADHQFDRYMKIKKAQTKKEKQIPNLEQPLNADSLSAYINYKFDERPEA
DDSSLIEMIEQLSALGYATLKDIDLIVEKSKSVLEIYEKDNPIRTQTAIKLDGVGALRIC
VALADYQNKDSSSFYVKDIQKYREFIND
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgttcatacctccaaacaccgcctctctaaaatctgaatacgctaaaaaaataggaact
tatcaatatctaatctcaaaaattaaaacattattgaatgaagatctattaactaaagaa
ataaagataatctcattaactgctagagaaaaaaaatttgattcattttacaaaaaaatt
tttcgatatgaaattgagggagattattttgtaaaaattgatgatttagctggagtaaga
attgtatgtgtgtatttggaggaaatggaaaaaattagaaatattatccaaaaaaacttt
caaattattcgtgaaaaacatcttaattttgataatcgtgtagacaaaactggatatcaa
tcagatcattatattgttaaattaaaaaaagagtcggttacaaatgctgacaaatttctt
catagtgatataggtaattgtttatgtgaaattcaagtcagaactgcactaatgcattct
tggtcctctgtttcacatgatcttttttacaagaaaaaattagttgaatctgattttgaa
cgagaaatgtatgcattaagtagtttattcttttttgcagatcatcaatttgatagatat
atgaaaattaaaaaggctcaaactaaaaaagaaaaacaaataccaaatttagaacaaccg
ttaaatgccgattccttatccgcctatattaactacaaatttgacgaaagacctgaagct
gatgactcatcgttaattgaaatgatagaacaattatctgcacttgggtatgctactctt
aaagacattgatttaatcgtagaaaaatcaaaatctgtattggaaatatatgaaaaagat
aatccaattcgtactcaaactgctatcaaattagatggagtgggtgctctaaggatttgt
gttgctcttgctgattatcaaaataaagacagctcaagtttctatgttaaagacattcag
aaatatagggaatttatcaatgattaa

DBGET integrated database retrieval system